| IED ID | IndEnz0002008269 |
| Enzyme Type ID | protease008269 |
| Protein Name |
Anti-sigma-K factor RskA Regulator of SigK Sigma-K anti-sigma factor RskA |
| Gene Name | rskA Mmcs_4372 |
| Organism | Mycobacterium sp. (strain MCS) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Actinobacteria Actinomycetia (high G+C Gram-positive bacteria) Corynebacteriales Mycobacteriaceae Mycobacterium unclassified Mycobacterium Mycobacterium sp. (strain MCS) |
| Enzyme Sequence | MTEPNNTDLLDLATPYALHAVSIDERFEIDRWLATAPPEVADAFTDEVRSVQETMAVLSAATATEPPAHLRDNVLAMVADDPVRDLGSARRRRGGESRWRTAVLAAAAVAVVGLGALGVGLALRPAVSPTTADQVFAAPDVQTVSGPIPGGGTATVVFSKERDAGVLVMNDVAPPKPGTVYQMWLVGSDGPHSAGTMDDKAISPSTTAVLSDIGTSQALAFTVEPPGGSQRPTSPAFAELPLT |
| Enzyme Length | 243 |
| Uniprot Accession Number | Q1B3Q7 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: An anti-sigma factor for extracytoplasmic function (ECF) sigma factor SigK. ECF sigma factors are held in an inactive form by an anti-sigma factor until released by regulated intramembrane proteolysis (RIP). RIP occurs when an extracytoplasmic signal triggers a concerted proteolytic cascade to transmit information and elicit cellular responses. The membrane-spanning regulatory substrate protein is first cut extracytoplasmically (site-1 protease, S1P), then within the membrane itself (site-2 protease, S2P, Rip1), while cytoplasmic proteases finish degrading the regulatory protein, liberating the sigma factor (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Region (1); Topological domain (2); Transmembrane (1) |
| Keywords | Cell membrane;Membrane;Transcription;Transcription regulation;Transmembrane;Transmembrane helix |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cell membrane {ECO:0000305}; Single-pass membrane protein {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 25,147 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |