| IED ID | IndEnz0002008274 |
| Enzyme Type ID | protease008274 |
| Protein Name |
Prophage Rz endopeptidase RzpD EC 3.4.-.- |
| Gene Name | rzpD ybcT b0556 JW5079 |
| Organism | Escherichia coli (strain K12) |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Escherichia Escherichia coli Escherichia coli (strain K12) |
| Enzyme Sequence | MSRVTAIISALIICIIVSLSWAVNHYRDNAIAYKVQRDKNARELKLANAAITDMQMRQRDVAALDAKYTKELADAKAENDALRDDVAAGRRRLHIKAVCQSVREATTASGVDNAASPRLADTAERDYFTLRERLITMQKQLEGTQKYINEQCR |
| Enzyme Length | 153 |
| Uniprot Accession Number | P75719 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.-.- |
| Enzyme Function | FUNCTION: Necessary for host cell lysis. It is believed to code for an endopeptidase that cleaves the amino-carboxyl cross-link between the diaminopimelic acid and D-alanine residues in the murein component of the bacterial cell wall (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Erroneous initiation (1) |
| Keywords | Antimicrobial;Bacteriolytic enzyme;Hydrolase;Protease;Reference proteome |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 17,226 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |