| IED ID | IndEnz0002008287 |
| Enzyme Type ID | protease008287 |
| Protein Name |
Stage V sporulation protein D EC 3.4.16.4 Sporulation-specific penicillin-binding protein |
| Gene Name | spoVD BSU15170 |
| Organism | Bacillus subtilis (strain 168) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus subtilis group Bacillus subtilis Bacillus subtilis subsp. subtilis Bacillus subtilis (strain 168) |
| Enzyme Sequence | MRVSNVTVRKRLLFVLLFGVIVFLIIDTRLGYVQFVMGEKLTSLAKDSWSRNLPFEPERGEILDRNGVKLATNKSAPTVFVVPRQVQNPMKTSKQLAAVLNMSEEKVYKHVTKKASIEKITPEGRKISNEKAKEIKALDLKGVYVAEDSIRHYPFGSFLSHVLGFAGIDNQGLLGLEAYYDDDLKGEKGSVKFYTDAKGKKMPDEADDYTPPKDGLDMKLTVDSKVQTIMERELDNAEAKYHPDGMIAVAMNPKNGEILGMSSRPDFDPADYQSVDPSVYNRNLPVWSTYEPGSTFKIITLAAALEEQKVNLKRDQFYDKGHAEVDGARLRCWKRGGHGLQTYLEVVQNSCNPGFVELGERLGKEKLFKYIKDFGFGQKTGIDLQGEGTGILFPLERVGPVEQATTAFGQGVSVTPIQQVAAVSAAVNGGTLYTPYIAKEWIDPVTKKTVKKQSPIAKKQVISEETSKQIRYALESVVAEGTGRNAFVEGYRVGGKTGTAQKVKDGKYLENNHIVSFIGFAPADDPSLVVYVAVDNPKGTIQFGGTVAAPIVGNIMRDSLPELGVKPRKNQIEKKYQWNDTKTIEVPNVVGMSVSDLESLLVNLNVDASGKGSKIVKQSPAAGTKVKEGSKIRVYLTEEDEKEAAD |
| Enzyme Length | 646 |
| Uniprot Accession Number | Q03524 |
| Absorption | |
| Active Site | ACT_SITE 294; /note=Acyl-ester intermediate; /evidence=ECO:0000250|UniProtKB:P0AD65 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Preferential cleavage: (Ac)(2)-L-Lys-D-Ala-|-D-Ala. Also transpeptidation of peptidyl-alanyl moieties that are N-acyl substituents of D-alanine.; EC=3.4.16.4; Evidence={ECO:0000305}; |
| DNA Binding | |
| EC Number | 3.4.16.4 |
| Enzyme Function | FUNCTION: Penicillin-binding protein with an unknown catalytic activity. May have a specialized role in the morphogenesis of spore cortex, which is a modified form of peptidoglycan. Spore cortex formation is determined primarily by the mother cell. {ECO:0000269|PubMed:8289242}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | PATHWAY: Cell wall biogenesis; peptidoglycan biosynthesis. |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Domain (1); Sequence conflict (1) |
| Keywords | Carboxypeptidase;Cell membrane;Cell shape;Cell wall biogenesis/degradation;Hydrolase;Membrane;Peptidoglycan synthesis;Protease;Reference proteome;Sporulation |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:8289242}; Peripheral membrane protein {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 71,118 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |