| IED ID | IndEnz0002008303 |
| Enzyme Type ID | protease008303 |
| Protein Name |
Neutrophilic granule protein NGP Cystatin-like protein Myeloid bactenecin protein Myeloid secondary granule protein |
| Gene Name | Ngp |
| Organism | Mus musculus (Mouse) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) |
| Enzyme Sequence | MAGLWKTFVLVVALAVVSCEALRQLRYEEIVDRAIEAYNQGRQGRPLFRLLSATPPSSQNPATNIPLQFRIKETECTSTQERQPKDCDFLEDGEERNCTGKFFRRRQSTSLTLTCDRDCSREDTQETSFNDKQDVSEKEKFEDVPPHIRNIYEDAKYDIIGNILKNF |
| Enzyme Length | 167 |
| Uniprot Accession Number | O08692 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Acts as an inhibitor of cathepsin B (CTSB) activity. Plays a role as a negative regulator of tumor vascular development, cell invasion and metastasis. {ECO:0000269|PubMed:21518852}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Region (1); Sequence conflict (1); Signal peptide (1) |
| Keywords | Direct protein sequencing;Disulfide bond;Protease inhibitor;Reference proteome;Secreted;Signal;Thiol protease inhibitor;Tumor suppressor |
| Interact With | |
| Induction | INDUCTION: Up-regulated by CCAAT/enhancer-binding proteins CEBPA and CEBPE and transcription factor SPI1 (at protein level) (PubMed:12515729). Down-regulated in malignant tumor conditioned medium (PubMed:21518852). Up-regulated during early bone marrow differentiation by the granulocyte-macrophage colony-stimulating factor CSF2 and down-regulated during granulocytic maturation (PubMed:8749713). {ECO:0000269|PubMed:12515729, ECO:0000269|PubMed:21518852, ECO:0000269|PubMed:8749713}. |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:21518852}. Cytoplasmic granule {ECO:0000269|PubMed:8749713}. Note=Localizes in cytoplasmic granules of neutrophilic precursors (PubMed:8749713). {ECO:0000269|PubMed:21518852, ECO:0000269|PubMed:8749713}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..21; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 11217851; 12466851; 14610273; 16602821; 21267068; 21677750; 2181376; 31720045; 9611252; |
| Motif | |
| Gene Encoded By | |
| Mass | 19,332 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |