| IED ID | IndEnz0002008338 |
| Enzyme Type ID | protease008338 |
| Protein Name |
Nuclear receptor-interacting protein 2 Neuronal-interacting factor X 1 |
| Gene Name | Nrip2 Nix1 |
| Organism | Mus musculus (Mouse) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) |
| Enzyme Sequence | MSTGQEARRDEGDSRKEQEASLRDRAHLSQQRQLKQATQFLHKDSADLLPLDSLKRLGTSKDLQPHSVIQRRLVEGNQRRLQGESPLLQALIRGHDSSRTSATQVPALLVNCKCQDQMLRVAVDTGTQHNQISAGCLRRLGLGKRVPKAPGGDVAPEPPTQVEQLELELGQETVACSAQVVDVDSPEFCLGLQTLLSLKLATSLSASSLLPSALGIPTESICDSEALVPHSLLSLPKCTTKSLTEKDLQQMGSRLHPGCRGQSYLLPPLA |
| Enzyme Length | 270 |
| Uniprot Accession Number | Q9JHR9 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Down-regulates transcriptional activation by nuclear receptors, such as NR1F2. {ECO:0000269|PubMed:10860982}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Alternative sequence (1); Chain (1); Compositional bias (1); Frameshift (1); Motif (1); Region (2); Sequence conflict (6) |
| Keywords | Alternative splicing;Nucleus;Reference proteome;Transcription;Transcription regulation |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Nucleus {ECO:0000269|PubMed:10860982}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 20059953; 20436479; 21267068; 21677750; 23117660; 24952961; 26496610; |
| Motif | MOTIF 192..196; /note=LXXLL motif |
| Gene Encoded By | |
| Mass | 29,284 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |