| IED ID | IndEnz0002008364 |
| Enzyme Type ID | protease008364 |
| Protein Name |
Proteasome subunit alpha type-7-A 20S proteasome alpha subunit D-1 Proteasome component 6A Proteasome subunit alpha type-4 TAS-G64 |
| Gene Name | PAD1 PRC6A At3g51260 F24M12.300 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MARYDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTDTVVLAVEKKSTPKLQDSRSARKIVSLDNHIALACAGLKADARVLINKARIECQSHRLTLEDPVTVEYITRYIAGLQQKYTQSGGVRPFGLSTLIVGFDPYTRIPALYQTDPSGTFSAWKANATGRNSNSIREFLEKNYKESAGQETVKLAIRALLEVVESGGKNIEVAVMTREEGVLKQLEEEEIDIIVAEIEAEKAAAEAAKKGPAKET |
| Enzyme Length | 250 |
| Uniprot Accession Number | P30186 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. Mediates the association of the SCF(TIR1) E3 ubiquitin ligase complex with the proteasome. {ECO:0000269|PubMed:11387208}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Cross-link (1); Sequence conflict (2) |
| Keywords | Alternative splicing;Cytoplasm;Isopeptide bond;Nucleus;Proteasome;Reference proteome;Ubl conjugation |
| Interact With | |
| Induction | INDUCTION: During cell proliferation. {ECO:0000269|PubMed:7987412}. |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250}. Nucleus {ECO:0000269|PubMed:11387208}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 10809753; 15028209; 15215502; 15821981; 17028202; 17151019; 17825468; 18552202; 18650403; 20118269; 21798944; 28627464; 30461017; |
| Motif | |
| Gene Encoded By | |
| Mass | 27,337 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |