| IED ID | IndEnz0002008374 |
| Enzyme Type ID | protease008374 |
| Protein Name |
Protease inhibitor SBPI |
| Gene Name | |
| Organism | Sarcophaga bullata (Grey flesh fly) (Neobellieria bullata) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Mandibulata Pancrustacea Hexapoda Insecta Dicondylia Pterygota (winged insects) Neoptera Endopterygota Diptera Brachycera Muscomorpha Eremoneura Cyclorrhapha Schizophora Calyptratae Oestroidea Sarcophagidae (flesh flies) Sarcophaginae Sarcophaga Neobellieria Sarcophaga bullata (Grey flesh fly) (Neobellieria bullata) |
| Enzyme Sequence | VDKSACLQPKEVGPCRKSDFVFFYNADTKACEEFLYGGCRGNDNRFNTKEECEKLCL |
| Enzyme Length | 57 |
| Uniprot Accession Number | P26228 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Seems to inhibit trypsin. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (3); Domain (1); Site (1) |
| Keywords | Direct protein sequencing;Disulfide bond;Protease inhibitor;Serine protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 6,518 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |