IED ID | IndEnz0002008392 |
Enzyme Type ID | protease008392 |
Protein Name |
26S proteasome regulatory subunit 7 homolog B 26S proteasome AAA-ATPase subunit RPT1b 26S proteasome subunit 7 homolog B Regulatory particle triple-A ATPase subunit 1b |
Gene Name | RPT1B At1g53780 T18A20.2 |
Organism | Arabidopsis thaliana (Mouse-ear cress) |
Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
Enzyme Sequence | MIIRDIMEDPENEGPHNMRSDFEPLLSVLRLRDYETGDIIEFDSTEASEEALSDITEFGSTEASEAHFEEPYSARIKKVEKEINELAEKICNLGIKESDTGLAPPNQWDLVSDKQMMQEEQPLLVATCTQIISPNTEDAKYVVDIKKIGKYVVGLGDKASPTDIEAGMRVGVDQKKYQIQIPLPPKIDPSVTMMTVEEKPDATYSDIGGCKEQIEKIREVVELPMLHPEKFVRLGIDPPKGVLCYGPPGSGKTLVARAVANRTGACFIRVVGSELVQKYIGEGARMVRELFQMARSKKACILFFDEIDAIGGARFDDGVGSDNEVQRTMLEILYQLDGFDARGNIKVLMATNRPDILDPALLRPGRLDRKVEFCLPDLEGRTQIFKIHTRTMSCERDIRFELLAGLCPNSTGADIRSVCIEAGMYAIGARRKSVTEKDFLDAVNKVVKGYQKFSATPKYMAYYI |
Enzyme Length | 464 |
Uniprot Accession Number | Q9SSB4 |
Absorption | |
Active Site | |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | |
DNA Binding | |
EC Number | |
Enzyme Function | FUNCTION: The 26S proteasome is involved in the ATP-dependent degradation of ubiquitinated proteins. The regulatory (or ATPase) complex confers ATP dependency and substrate specificity to the 26S complex. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | NP_BIND 246..253; /note=ATP; /evidence=ECO:0000255 |
Features | Chain (1); Cross-link (1); Erroneous gene model prediction (1); Nucleotide binding (1) |
Keywords | ATP-binding;Alternative splicing;Cytoplasm;Isopeptide bond;Nucleotide-binding;Nucleus;Proteasome;Reference proteome;Ubl conjugation |
Interact With | |
Induction | |
Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250}. Nucleus {ECO:0000250}. |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | 14623884; |
Motif | |
Gene Encoded By | |
Mass | 51,811 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |