| IED ID | IndEnz0002008398 |
| Enzyme Type ID | protease008398 |
| Protein Name |
Proteasome subunit beta type-1 20S proteasome beta subunit F-1 Proteasome component 5 Proteasome subunit beta type-6 TAS-F22/FAFP98 TAS-G39.20 |
| Gene Name | PBF1 PRC5 At3g60820 T4C21_230 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MTKQHANWSPYDNNGGTCVAIAGSDYCVIAADTRMSTGYSILSRDYSKIHKLADRAVLSSSGFQADVKALQKVLKSRHLIYQHQHNKQMSCPAMAQLLSNTLYFKRFFPYYAFNVLGGLDEEGKGCVFTYDAVGSYERVGYGAQGSGSTLIMPFLDNQLKSPSPLLLPKQDSNTPLSEAEAVDLVKTVFASATERDIYTGDKLEIMILKADGIKTELMDLRKD |
| Enzyme Length | 223 |
| Uniprot Accession Number | P42742 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Non-catalytic component of the proteasome, a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Erroneous initiation (1) |
| Keywords | Alternative splicing;Cytoplasm;Nucleus;Proteasome;Reference proteome |
| Interact With | |
| Induction | INDUCTION: During cell proliferation. {ECO:0000269|PubMed:7987412}. |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000255|PROSITE-ProRule:PRU00809}. Nucleus {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 12952558; 15028209; 15769804; 16055689; 17644812; 17825468; 18650403; 19857612; 20118269; 21798377; 21798944; 23991809; 26909098; 28627464; 32416015; 9373170; |
| Motif | |
| Gene Encoded By | |
| Mass | 24,644 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |