| IED ID | IndEnz0002008408 |
| Enzyme Type ID | protease008408 |
| Protein Name |
Trialysin Triatoma infestans cytolysin |
| Gene Name | |
| Organism | Triatoma infestans (Assassin bug) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Mandibulata Pancrustacea Hexapoda Insecta Dicondylia Pterygota (winged insects) Neoptera Paraneoptera Hemiptera Prosorrhyncha (bugs) Heteroptera (true bugs) Euheteroptera Neoheteroptera Panheteroptera Cimicomorpha Reduvioidea Reduviidae (assassin bugs) Triatominae (kissing bugs) Triatoma Triatoma infestans (Assassin bug) |
| Enzyme Sequence | MSKFWLLLLLVAAFQFAHSYPAAEYELDETTNDEVRQFIGDGYFEDEGDDGDEERFKIKPGKVLDKFGKIVGKVLKQLKKVSAVAKVAMKKGAALLKKMGVKISPLKCEEKTCKSCVIFKIPTENSFCLTIRFMKTNIATYLVVAGEINRKSKFEEKLKLGNMPRCVNVEGFIGKVCMKGIEGHAKSSSGQANVNFCLGLVAEKFGVGAKLCGIYANKKVRVKISPQLFPGATSLDGDIVKLDDNGEDATTLDVDEVEID |
| Enzyme Length | 260 |
| Uniprot Accession Number | Q8T0Z3 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Pore-forming protein that induces lysis of T.cruzi trypomastigotes, bacteria E.coli and human red blood cells (PubMed:11751887). The parasite lysis is much more important than the hemolysis, probably due to difference in membrane composition (PubMed:11751887). Its action on protozoan parasites and bacteria may indicate a role in the control of microorganism growth in the salivary glands (PubMed:11751887). {ECO:0000269|PubMed:11751887}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Natural variant (6); Propeptide (1); Sequence conflict (2); Signal peptide (1) |
| Keywords | Antibiotic;Antimicrobial;Cytolysis;Direct protein sequencing;Hemolysis;Ion transport;Membrane;Secreted;Signal;Target cell membrane;Target membrane;Transmembrane;Transport |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:11751887}. Target cell membrane {ECO:0000305|PubMed:11751887}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..19; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 28,593 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |