| IED ID | IndEnz0002008413 |
| Enzyme Type ID | protease008413 |
| Protein Name |
Serine protease inhibitor swm-1 Sperm activation without mating protein 1 |
| Gene Name | swm-1 C25E10.9 |
| Organism | Caenorhabditis elegans |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Nematoda (roundworms) Chromadorea Rhabditida Rhabditina Rhabditomorpha Rhabditoidea Rhabditidae Peloderinae Caenorhabditis Caenorhabditis elegans |
| Enzyme Sequence | MRILVIITCIVAVATATKTCEANEELVSCHNTCEPQCGYTPKACTEQCIMNTCDCKDGFVRNSLGKCVEVSECTKETTKCPENETFFGCGTACEATCEKPNPTVCTKQCIVNVCQCSKGFVRHGLRCIDKKDCPK |
| Enzyme Length | 135 |
| Uniprot Accession Number | Q18158 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Serine protease inhibitor (Probable) (PubMed:22125495). Probably by inhibiting serine protease tyr-5 in males, prevents the maturation of spermatids into mature motile spermatozoa until their transfer into a hermaphrodite (PubMed:16461278, PubMed:22125495, PubMed:30470702). Also required for efficient sperm transfer and thus for male fertility (PubMed:16461278). {ECO:0000269|PubMed:16461278, ECO:0000269|PubMed:22125495, ECO:0000269|PubMed:30470702, ECO:0000305|PubMed:16461278}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (10); Domain (2); Glycosylation (1); Mutagenesis (2); Signal peptide (1) |
| Keywords | Cytoplasmic vesicle;Differentiation;Disulfide bond;Glycoprotein;Protease inhibitor;Reference proteome;Repeat;Secreted;Serine protease inhibitor;Signal;Spermatogenesis |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:30470702}. Cytoplasmic vesicle, secretory vesicle lumen {ECO:0000269|PubMed:30470702}. Note=In males, partially colocalizes with tyr-5 in vesicles near the apical membrane of cuboidal cells. Secreted predominantly by muscles into the pseudocoelom where it enters the seminal vesicle in males and the spermatheca in hermaphrodites. Localizes around the spermatocytes at the late stages of meiosis. During mating, transferred together with sperm into hermaphrodites where it spread into the uterus. Also, is uptaken by coelomocytes. {ECO:0000269|PubMed:30470702}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..16; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 19922876; 21367940; 22042574; 22560298; 23800452; 25487147; 25635455; |
| Motif | |
| Gene Encoded By | |
| Mass | 14,737 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |