| IED ID | IndEnz0002008445 |
| Enzyme Type ID | protease008445 |
| Protein Name |
ECF RNA polymerase sigma factor SigM ECF sigma factor SigM Alternative RNA polymerase sigma factor SigM RNA polymerase sigma-M factor Sigma-M factor |
| Gene Name | sigM Rv3911 |
| Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Actinobacteria Actinomycetia (high G+C Gram-positive bacteria) Corynebacteriales Mycobacteriaceae Mycobacterium Mycobacterium tuberculosis complex Mycobacterium tuberculosis Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Enzyme Sequence | MPPPIGYCPAVGFGGRHERSDAELLAAHVAGDRYAFDQLFRRHHRQLHRLARLTSRTSEDADDALQDAMLSAHRGAGSFRYDAAVSSWLHRIVVNACLDRLRRAKAHPTAPLEDVYPVADRTAQVETAIAVQRALMRLPVEQRAAVVAVDMQGYSIADTARMLGVAEGTVKSRCARARARLARLLGYLNTGVNIRR |
| Enzyme Length | 196 |
| Uniprot Accession Number | O53590 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | DNA_BIND 156..175; /note=H-T-H motif; /evidence=ECO:0000250 |
| EC Number | |
| Enzyme Function | FUNCTION: Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. Extracytoplasmic function (ECF) sigma factors are held in an inactive form by an anti-sigma factor (RsaM, AC L7N5D7) until released by regulated intramembrane proteolysis (Probable). This sigma factor is required for the synthesis of surface or secreted molecules. {ECO:0000269|PubMed:17028284, ECO:0000305}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); DNA binding (1); Frameshift (1); Motif (1); Region (2) |
| Keywords | DNA-binding;Reference proteome;Sigma factor;Transcription;Transcription regulation |
| Interact With | |
| Induction | INDUCTION: Constitutively low in all growth stages; repressed by detergent (3.5-fold). Induced by WhiB5. {ECO:0000269|PubMed:10027986, ECO:0000269|PubMed:17028284, ECO:0000269|PubMed:22733573}. |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | MOTIF 63..66; /note=Polymerase core binding; /evidence=ECO:0000255 |
| Gene Encoded By | |
| Mass | 21,649 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |