| IED ID | IndEnz0002008450 |
| Enzyme Type ID | protease008450 |
| Protein Name |
ECF RNA polymerase sigma factor SigK ECF sigma factor SigK Alternative RNA polymerase sigma factor SigK RNA polymerase sigma-K factor Sigma-K factor |
| Gene Name | sigK BCG_0484c |
| Organism | Mycobacterium bovis (strain BCG / Pasteur 1173P2) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Actinobacteria Actinomycetia (high G+C Gram-positive bacteria) Corynebacteriales Mycobacteriaceae Mycobacterium Mycobacterium tuberculosis complex Mycobacterium tuberculosis Mycobacterium bovis Mycobacterium tuberculosis variant bovis BCG Mycobacterium bovis (strain BCG / Pasteur 1173P2) |
| Enzyme Sequence | MTGPPRLSSDLDALLRRVAGHDQAAFAEFYDHTKSRVYGLVMRVLRDTGYSEETTQEIYLEVWRNASEFDSAKGSALAWLLTMAHRRAVDRVRCEQAGNQREVRYGAANVDPASDVVADLAIAGDERRRVTECLKALTDTQRQCIELAYYGGLTYVEVSRRLAANLSTIKSRMRDALRSLRNCLDVS |
| Enzyme Length | 187 |
| Uniprot Accession Number | A1KFR7 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | DNA_BIND 155..174; /note=H-T-H motif; /evidence=ECO:0000250 |
| EC Number | |
| Enzyme Function | FUNCTION: Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. Extracytoplasmic function (ECF) sigma factors are held in an inactive form by an anti-sigma factor until released by regulated intramembrane proteolysis. Sigma-K controls genes such as mpb70 and mpb83. However, in strains with the start codon mutation (AUA), there is a decrease in SigK expression, thus affecting SigK-regulated genes expression as well. {ECO:0000269|PubMed:15882422}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); DNA binding (1); Motif (1); Region (2) |
| Keywords | DNA-binding;Sigma factor;Transcription;Transcription regulation |
| Interact With | |
| Induction | INDUCTION: Autoregulated. {ECO:0000269|PubMed:15882422}. |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | MOTIF 53..56; /note=Interaction with polymerase core subunit RpoC |
| Gene Encoded By | |
| Mass | 21,035 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |