| IED ID | IndEnz0002008473 |
| Enzyme Type ID | protease008473 |
| Protein Name |
Serpin-Z1 ArathZ1 |
| Gene Name | At1g64030 F22C12.22 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MDVREAMKNQTHVAMILSGHVLSSAPKDSNVIFSPASINSAITMHAAGPGGDLVSGQILSFLRSSSIDELKTVFRELASVVYADRSATGGPKITAANGLWIDKSLPTDPKFKDLFENFFKAVYVPVDFRSEAEEVRKEVNSWVEHHTNNLIKDLLPDGSVTSLTNKIYANALSFKGAWKRPFEKYYTRDNDFYLVNGTSVSVPFMSSYENQYVRAYDGFKVLRLPYQRGSDDTNRKFSMYFYLPDKKDGLDDLLEKMASTPGFLDSHIPTYRDELEKFRIPKFKIEFGFSVTSVLDRLGLRSMSMYHKACVEIDEEGAEAAAATADGDCGCSLDFVEPPKKIDFVADHPFLFLIREEKTGTVLFVGQIFDPSGPCSGSNSDSDDY |
| Enzyme Length | 385 |
| Uniprot Accession Number | Q9SH52 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Probable serine protease inhibitor. {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Erroneous gene model prediction (1); Region (1); Site (1) |
| Keywords | Protease inhibitor;Reference proteome;Serine protease inhibitor |
| Interact With | |
| Induction | INDUCTION: By beta-amino-butyric acid (BABA) and infection by Pseudomonas pathogen. {ECO:0000269|PubMed:18060440}. |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 19426562; |
| Motif | |
| Gene Encoded By | |
| Mass | 42,987 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |