| IED ID | IndEnz0002008490 |
| Enzyme Type ID | protease008490 |
| Protein Name |
Cornifin-A 19 kDa pancornulin SPRK Small proline-rich protein IA SPR-IA |
| Gene Name | SPRR1A |
| Organism | Homo sapiens (Human) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Homininae Homo Homo sapiens (Human) |
| Enzyme Sequence | MNSQQQKQPCTPPPQPQQQQVKQPCQPPPQEPCIPKTKEPCHPKVPEPCHPKVPEPCQPKVPEPCQPKVPEPCPSTVTPAPAQQKTKQK |
| Enzyme Length | 89 |
| Uniprot Accession Number | P35321 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Compositional bias (1); Natural variant (2); Region (4); Repeat (8); Sequence conflict (2) |
| Keywords | Cytoplasm;Direct protein sequencing;Keratinization;Reference proteome;Repeat |
| Interact With | Q8NBF1 |
| Induction | INDUCTION: During squamous differentiation of epidermal keratinocytes. |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 10066784; 10411887; 10771479; 11350120; 11590230; 12902340; 16639001; 17515931; 18643845; 19601998; 19672094; 21654840; 22810585; 24189400; 24886019; 25424702; 25609649; 27304082; 30652380; 7543090; 8999895; 9395522; 9565599; |
| Motif | |
| Gene Encoded By | |
| Mass | 9,877 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |