| IED ID | IndEnz0002008553 |
| Enzyme Type ID | protease008553 |
| Protein Name |
Protein PBN1 Protease B non-derepressible protein 1 |
| Gene Name | PBN1 YCL052C YCL52C |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Saccharomycotina (true yeasts) Saccharomycetes Saccharomycetales Saccharomycetaceae Saccharomyces Saccharomyces cerevisiae (Baker's yeast) Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) |
| Enzyme Sequence | MVTRHRVTVLYNAPEDIGNHMRQNDTHLTVRGGSGVVLQQRWLLERTGSLDKSFTRITWRPRADLARSLSVIENELSAGFSVYSNSSDVPERFITNPVYNSFHSEKFDIEQYLPPEVDLNLSWNPEDFTYDISVEPTQIQIVEYRLLKQGEEFTIARVKDEKLEVGVFFVDASDESDVDIGGIRCNWRMDDGKMERCQKTSLLYKQGHIAYNHSTTTTSLYLNEPIGLHPKIMIDLTDFEERPKCMYLMHLQLPLELFIDKFQSSPLLLFGEDDLELPEYSLRDKAWGSESIFELKAGTMNEVTLHTRYIEPSNNKGDKLEVSFDPEVILACDTGDNKVSRNPFYKKGLGYESLFTDDTTFRHLNSTTLLVPIPRPDTKDYSKIKNGTLLCLLISIIYIFSKVFGNNKKKRSVKRE |
| Enzyme Length | 416 |
| Uniprot Accession Number | P25580 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Required for proper folding and/or the stability of a subset of proteins in the endoplasmic reticulum. Aids the autocatalytic processing of PRB1. Component of glycosylphosphatidylinositol-mannosyltransferase 1 which transfers the first of the 4 mannoses in the GPI-anchor precursors during GPI-anchor biosynthesis. Probably acts by stabilizing the mannosyltransferase GPI14. {ECO:0000269|PubMed:15635094, ECO:0000269|PubMed:16418276, ECO:0000269|PubMed:9649520}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | PATHWAY: Glycolipid biosynthesis; glycosylphosphatidylinositol-anchor biosynthesis. |
| nucleotide Binding | |
| Features | Chain (1); Glycosylation (5); Topological domain (2); Transmembrane (1) |
| Keywords | Endoplasmic reticulum;GPI-anchor biosynthesis;Glycoprotein;Membrane;Reference proteome;Transmembrane;Transmembrane helix |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Endoplasmic reticulum membrane {ECO:0000269|PubMed:9649520}; Single-pass type III membrane protein {ECO:0000269|PubMed:9649520}. |
| Modified Residue | |
| Post Translational Modification | PTM: N-glycosylated. {ECO:0000269|PubMed:9649520}. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 16093310; 16859984; 17233591; 17361015; 19536198; 19841731; 19883648; 20174551; 21266254; 23135325; 23209158; |
| Motif | |
| Gene Encoded By | |
| Mass | 47,923 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda | 3.4.21.48; |