| IED ID | IndEnz0002008642 |
| Enzyme Type ID | protease008642 |
| Protein Name |
Non-specific lipid-transfer protein 1 LTP 1 PAPI |
| Gene Name | LTP Os12g0115100 LOC_Os12g02320 OsJ_033644 |
| Organism | Oryza sativa subsp. japonica (Rice) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae Liliopsida Petrosaviidae commelinids Poales Poaceae BOP clade Oryzoideae Oryzeae Oryzinae Oryza Oryza sativa (Rice) Oryza sativa subsp. japonica (Rice) |
| Enzyme Sequence | MARAQLVLVALVAALLLAAPHAAVAITCGQVNSAVGPCLTYARGGAGPSAACCSGVRSLKAAASTTADRRTACNCLKNAARGIKGLNAGNAASIPSKCGVSVPYTISASIDCSRVS |
| Enzyme Length | 116 |
| Uniprot Accession Number | Q0IQK9 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (2); Chain (1); Disulfide bond (4); Helix (8); Signal peptide (1) |
| Keywords | 3D-structure;Direct protein sequencing;Disulfide bond;Lipid-binding;Reference proteome;Signal;Transport |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..25; /evidence=ECO:0000269|PubMed:2458699 |
| Structure 3D | NMR spectroscopy (1); X-ray crystallography (4) |
| Cross Reference PDB | 1BV2; 1RZL; 1UVA; 1UVB; 1UVC; |
| Mapped Pubmed ID | 10092854; 15295114; |
| Motif | |
| Gene Encoded By | |
| Mass | 11,345 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |