| IED ID | IndEnz0002008653 |
| Enzyme Type ID | protease008653 |
| Protein Name |
Protease 7 EC 3.4.23.49 Omptin Outer membrane protein 3B Protease A Protease VII |
| Gene Name | ompT Z1931 ECs1663 |
| Organism | Escherichia coli O157:H7 |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Escherichia Escherichia coli Escherichia coli O157:H7 |
| Enzyme Sequence | MRAKLLGIVLTTPIAISSFASTETLSFTPDNINADISLGTLSGKTKERVYLAEEGGRKVSQLDWKFNNAAIIKGAINWDLMPQISIGAAGWTTLGSRGGNMVDQDWMDSSNPGTWTDESRHPDTQLNYANEFDLNIKGWLLNEPNYRLGLMAGYQESRYSFTARGGSYIYSSEEGFRDDIGSFPNGERAIGYKQRFKMPYIGLTGSYRYEDFELGGTFKYSGWVEASDNDEHYDPGKRITYRSKVKDQNYYSVSVNAGYYVTPNAKVYVEGTWNRVTNKKGNTSLYDHNDNTSDYSKNGAGIENYNFITTAGLKYTF |
| Enzyme Length | 317 |
| Uniprot Accession Number | P58603 |
| Absorption | |
| Active Site | ACT_SITE 103; /evidence=ECO:0000305; ACT_SITE 105; /evidence=ECO:0000305; ACT_SITE 230; /evidence=ECO:0000305; ACT_SITE 232; /evidence=ECO:0000305 |
| Activity Regulation | ACTIVITY REGULATION: Inhibited by zinc. {ECO:0000250}. |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Has a virtual requirement for Arg in the P1 position and a slightly less stringent preference for this residue in the P1' position, which can also contain Lys, Gly or Val.; EC=3.4.23.49; |
| DNA Binding | |
| EC Number | 3.4.23.49 |
| Enzyme Function | FUNCTION: Protease that can cleave T7 RNA polymerase, ferric enterobactin receptor protein (FEP), antimicrobial peptide protamine and other proteins. This protease has a specificity for paired basic residues (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (4); Chain (1); Signal peptide (1); Topological domain (11); Transmembrane (10) |
| Keywords | Aspartyl protease;Cell outer membrane;Hydrolase;Membrane;Protease;Reference proteome;Signal;Transmembrane;Transmembrane beta strand |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cell outer membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..20; /evidence=ECO:0000250 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 35,593 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda | 3.4.23.49; |