| IED ID | IndEnz0002008707 |
| Enzyme Type ID | protease008707 |
| Protein Name |
Presenilin-2 PS-2 EC 3.4.23.- Cleaved into: Presenilin-2 NTF subunit; Presenilin-2 CTF subunit |
| Gene Name | PSEN2 |
| Organism | Gallus gallus (Chicken) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Sauropsida Sauria (diapsids) Archelosauria Archosauria Dinosauria Saurischia Theropoda Coelurosauria Aves Neognathae Galloanserae Galliformes Phasianidae (turkeys) Phasianinae Gallus Gallus gallus (Chicken) |
| Enzyme Sequence | MITFMNNSDSEDEPCNERTSLMSAESPPVPSYQDGLQASETREAQTHRKRQTGSSRSPNNVADEDASDSDVRVRESALENEEEELTLKYGAKHVIMLFVPVTLCMIVVVATIKSVRFYTEKNGQLIYTPFSEDTPSVGQRLLNSVLNTIIMISVIVVMTVFLVVLYKYRCYKFIHGWLILSSFMLLFLFTYIYLGEVLKTYNVAMDYPTVILIIWNFGAVGMIRIHWKGPLQLQQAYLIMISALMVLVFIKYLPEWSAWVILGAISIYDLIAVLCPKGPLRMLXETAQERNQPIFPALIYSSAMIWTVGMAKPDTAAKGQSQQAWDAEDERENHSSTSHSDSQILDTRSPAPSHPITLEEMEEEERGVKLGLGDFIFYSVLVGKAAATPSGDWNTTLAXXVAILIGLCLTLLLLAVFKKALPALPISITFGLIFYFSTDNLVRTDPLEISV |
| Enzyme Length | 451 |
| Uniprot Accession Number | Q90X07 |
| Absorption | |
| Active Site | ACT_SITE 269; /evidence=ECO:0000250; ACT_SITE 374; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.23.- |
| Enzyme Function | FUNCTION: Probable catalytic subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral membrane proteins such as Notch receptors and APP (amyloid-beta precursor protein). Requires the other members of the gamma-secretase complex to have a protease activity. May play a role in intracellular signaling and gene expression or in linking chromatin to the nuclear membrane. May function in the cytoplasmic partitioning of proteins. The holoprotein functions as a calcium-leak channel that allows the passive movement of calcium from endoplasmic reticulum to cytosol and is involved in calcium homeostasis. Is a regulator of mitochondrion-endoplasmic reticulum membrane tethering and modulates calcium ions shuttling between ER and mitochondria. {ECO:0000250|UniProtKB:P49810}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Chain (2); Compositional bias (2); Intramembrane (1); Motif (1); Region (2); Topological domain (10); Transmembrane (8) |
| Keywords | Endoplasmic reticulum;Golgi apparatus;Hydrolase;Membrane;Notch signaling pathway;Protease;Reference proteome;Transmembrane;Transmembrane helix |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. Golgi apparatus membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | MOTIF 422..424; /note=PAL |
| Gene Encoded By | |
| Mass | 50,500 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |