| IED ID | IndEnz0002008725 |
| Enzyme Type ID | protease008725 |
| Protein Name |
Sorcin 22 kDa protein CP-22 CP22 V19 |
| Gene Name | SRI |
| Organism | Homo sapiens (Human) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Homininae Homo Homo sapiens (Human) |
| Enzyme Sequence | MAYPGHPGAGGGYYPGGYGGAPGGPAFPGQTQDPLYGYFAAVAGQDGQIDADELQRCLTQSGIAGGYKPFNLETCRLMVSMLDRDMSGTMGFNEFKELWAVLNGWRQHFISFDTDRSGTVDPQELQKALTTMGFRLSPQAVNSIAKRYSTNGKITFDDYIACCVKLRALTDSFRRRDTAQQGVVNFPYDDFIQCVMSV |
| Enzyme Length | 198 |
| Uniprot Accession Number | P30626 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | CA_BIND 83..94; /note=1; /evidence=ECO:0000305; CA_BIND 113..124; /note=2; /evidence=ECO:0000305 |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Calcium-binding protein that modulates excitation-contraction coupling in the heart. Contributes to calcium homeostasis in the heart sarcoplasmic reticulum. Modulates the activity of RYR2 calcium channels. {ECO:0000269|PubMed:17699613}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Alternative sequence (2); Beta strand (7); Calcium binding (2); Chain (1); Domain (4); Helix (11); Mutagenesis (1); Turn (1) |
| Keywords | 3D-structure;Alternative splicing;Calcium;Cytoplasm;Direct protein sequencing;Membrane;Metal-binding;Reference proteome;Repeat;Sarcoplasmic reticulum |
| Interact With | Q13137; Q08493-2; Q08493-3; Q9NZ81; P40763; Q99081; Q8N6Y0; P20073; Itself |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm. Sarcoplasmic reticulum membrane; Peripheral membrane protein; Cytoplasmic side. Note=Relocates to the sarcoplasmic reticulum membrane in response to elevated calcium levels. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (6) |
| Cross Reference PDB | 1JUO; 2JC2; 4U8D; 4UPG; 4USL; 5MRA; |
| Mapped Pubmed ID | 10748169; 10830164; 11922676; 12406570; 12408767; 12411058; 12754254; 1374913; 15147738; 15231748; 15754088; 15808837; 15916532; 16189514; 16320026; 16931553; 16934756; 17446270; 17541155; 17881003; 18315902; 18423116; 18624398; 19738201; 19885748; 19913121; 20012234; 20298697; 20388639; 20628086; 20647321; 20711500; 20858460; 21109982; 21988832; 22052463; 22338092; 22575643; 22623428; 22701893; 2298749; 2321095; 23362265; 23602568; 24013575; 24337682; 24376145; 24427308; 24796664; 25197934; 2536303; 25416956; 25567655; 26045737; 26421717; 26514267; 26577048; 26719254; 28726784; 2953725; 30144438; 31585896; 32305337; 33060591; 33960419; 34163033; 34205207; 7588753; 7702581; 7929371; 8021246; 8809036; 9395096; |
| Motif | |
| Gene Encoded By | |
| Mass | 21,676 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |