IED ID | IndEnz0002008757 |
Enzyme Type ID | protease008757 |
Protein Name |
Serpin B10 Proteinase inhibitor 10 |
Gene Name | SERPINB10 |
Organism | Rhinolophus ferrumequinum (Greater horseshoe bat) |
Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Laurasiatheria Chiroptera Microchiroptera Rhinolophidae (Old World leaf-nosed bats) Rhinolophinae Rhinolophus Rhinolophus ferrumequinum (Greater horseshoe bat) |
Enzyme Sequence | MDSLTKSINQFALEFSKKLAESAEGKNIFFSPWGISTSLAMVYLGTRGTTAAQIAQVLQFNRDQDSKFFPESEKKRKMDFNSRKVEEIRSDFQTLISEINNPSNAYVLKTANGIYGEKTYPFHNKYLEDMKTYFGVEPQSVNFLEAPDQTRNEINSWVESQTQGKILNLLPDDAVDSATRMVLVNAIYFKGIWEHQFSARDTREKPFRINKNTSKPVQMMSMKKKLQVFHIENPQAIGLQLYYESRDLSLFLLLPEDVSGLDQLEKAVTYEKLSEWTSADMMELYDVQLHLPKFKLEESYDLKSALSSMGMSDAFNQSKADFSGMSVEGNLFLSNVFHKSFVEINEQGTEASAGTGSEVSLRIRLPSIEFNADHPFLFFIRHNKTNSILFYGRFCSP |
Enzyme Length | 397 |
Uniprot Accession Number | B2KI30 |
Absorption | |
Active Site | |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | |
DNA Binding | |
EC Number | |
Enzyme Function | FUNCTION: Protease inhibitor that may play a role in the regulation of protease activities during hematopoiesis and apoptosis induced by TNF. May regulate protease activities in the cytoplasm and in the nucleus (By similarity). {ECO:0000250}. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Chain (1); Motif (1); Site (1) |
Keywords | Cytoplasm;Nucleus;Protease inhibitor;Reference proteome;Serine protease inhibitor |
Interact With | |
Induction | |
Subcellular Location | SUBCELLULAR LOCATION: Nucleus {ECO:0000250}. Cytoplasm {ECO:0000250}. |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | MOTIF 74..77; /note=Nuclear localization signal; /evidence=ECO:0000250 |
Gene Encoded By | |
Mass | 45,401 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |