| IED ID | IndEnz0002008762 |
| Enzyme Type ID | protease008762 |
| Protein Name |
Staphostatin B Staphylococcal cysteine protease B inhibitor |
| Gene Name | sspC SAOUHSC_00986 |
| Organism | Staphylococcus aureus (strain NCTC 8325 / PS 47) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus aureus Staphylococcus aureus (strain NCTC 8325 / PS 47) |
| Enzyme Sequence | MYQLQFINLVYDTTKLTHLEQTNINLFIGNWSNHQLQKSICIRHGDDTSHNQYHILFIDTAHQRIKFSSIDNEEIIYILDYDDTQHILMQTSSKQGIGTSRPIVYERLV |
| Enzyme Length | 109 |
| Uniprot Accession Number | Q9EYW6 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Specifically inhibits the cysteine protease staphopain B (SspB) by blocking the active site of the enzyme. Probably required to protect cytoplasmic proteins from being degraded by prematurely activated/folded prostaphopain B. Also involved in growth capacity, viability and bacterial morphology. {ECO:0000269|PubMed:12890028, ECO:0000269|PubMed:15716447}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (8); Chain (1); Helix (2); Mutagenesis (1); Region (1); Turn (2) |
| Keywords | 3D-structure;Cytoplasm;Direct protein sequencing;Protease inhibitor;Reference proteome;Thiol protease inhibitor;Virulence |
| Interact With | |
| Induction | INDUCTION: Expression occurs in a growth-phase-dependent manner with optimal expression at post-exponential phase. Up-regulated by Agr (accessory gene regulator) and repressed by SarA (staphylococcal accessory regulator) and sigmaB factor. {ECO:0000269|PubMed:14702415}. |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:12890028}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (2) |
| Cross Reference PDB | 1PXV; 1Y4H; |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 12,882 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |