Detail Information for IndEnz0002008763
IED ID IndEnz0002008763
Enzyme Type ID protease008763
Protein Name Staphostatin B
Staphylococcal cysteine protease B inhibitor
Gene Name sspC SAR1020
Organism Staphylococcus aureus (strain MRSA252)
Taxonomic Lineage cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus aureus Staphylococcus aureus (strain MRSA252)
Enzyme Sequence MYQLQFINLVYDTTKLTHLEQTNINLFIGNWSNHQLQKSICIRHGDDTSHNQYHILFIDTAHQRIKFSSFDNEEIIYILDYDDTQHILMQTSSKQGIGTSRPIVYERLV
Enzyme Length 109
Uniprot Accession Number Q6GI36
Absorption
Active Site
Activity Regulation
Binding Site
Calcium Binding
catalytic Activity
DNA Binding
EC Number
Enzyme Function FUNCTION: Specifically inhibits the cysteine protease staphopain B (SspB) by blocking the active site of the enzyme. Probably required to protect cytoplasmic proteins from being degraded by prematurely activated/folded prostaphopain B. Also involved in growth capacity, viability and bacterial morphology (By similarity). {ECO:0000250}.
Temperature Dependency
PH Dependency
Pathway
nucleotide Binding
Features Chain (1); Region (1)
Keywords Cytoplasm;Protease inhibitor;Thiol protease inhibitor;Virulence
Interact With
Induction
Subcellular Location SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250}.
Modified Residue
Post Translational Modification
Signal Peptide
Structure 3D
Cross Reference PDB -
Mapped Pubmed ID -
Motif
Gene Encoded By
Mass 12,916
Kinetics
Metal Binding
Rhea ID
Cross Reference Brenda