| IED ID | IndEnz0002008798 |
| Enzyme Type ID | protease008798 |
| Protein Name |
Small, acid-soluble spore protein gamma-type SASP |
| Gene Name | |
| Organism | Laceyella sacchari (Thermoactinomyces thalpophilus) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Thermoactinomycetaceae Laceyella Laceyella sacchari (Thermoactinomyces thalpophilus) |
| Enzyme Sequence | MNTKNFTPQESRTNAQQVRQQNQQSAQGTSSGFATEFASETNAQQVRQQNQQSAQANRMSGATAGGFNTEFASETNVQQVRQQNQQSEAKKRNNQQ |
| Enzyme Length | 96 |
| Uniprot Accession Number | P07786 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: SASP are proteins degraded in the first minutes of spore germination and provide amino acids for both new protein synthesis and metabolism. These proteins may be involved in dormant spore's high resistance to UV light. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Region (1); Repeat (2); Site (2) |
| Keywords | Repeat;Sporulation |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 10,683 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |