| IED ID | IndEnz0002008823 |
| Enzyme Type ID | protease008823 |
| Protein Name |
Sortase A EC 3.4.22.- |
| Gene Name | srtA BAS0654 |
| Organism | Bacillus anthracis |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus cereus group Bacillus anthracis |
| Enzyme Sequence | MNKQRIYSIVAILLFVVGGVLIGKPFYDGYQAEKKQTENVQAVQKMDYEKHETEFVDASKIDQPDLAEVANASLDKKQVIGRISIPSVSLELPVLKSSTEKNLLSGAATVKENQVMGKGNYALAGHNMSKKGVLFSDIASLKKGDKIYLYDNENEYEYAVTGVSEVTPDKWEVVEDHGKDEITLITCVSVKDNSKRYVVAGDLVGTKAKK |
| Enzyme Length | 210 |
| Uniprot Accession Number | P0DPQ5 |
| Absorption | |
| Active Site | ACT_SITE 126; /note=Proton donor/acceptor; /evidence=ECO:0000250|UniProtKB:Q2FV99; ACT_SITE 187; /note=Acyl-thioester intermediate; /evidence=ECO:0000250|UniProtKB:Q2FV99 |
| Activity Regulation | ACTIVITY REGULATION: Inhibited by thiol-reactive reagents. {ECO:0000269|PubMed:15968076}. |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.22.- |
| Enzyme Function | FUNCTION: Transpeptidase that anchors surface proteins to the cell wall (PubMed:15968076). Recognizes and modifies its substrate by proteolytic cleavage of a C-terminal sorting signal. Following cleavage, a covalent intermediate is formed via a thioester bond between the sortase and its substrate, which is then transferred and covalently attached to the cell wall (PubMed:15968076). This sortase recognizes a Leu-Pro-x-Thr-Gly (LPXTG) motif, which is cleaved by the sortase between the threonine and glycine residues (PubMed:15968076). Important for growth in macrophages. May be critical in the early stages of inhalation anthrax (PubMed:16041044). {ECO:0000269|PubMed:15968076, ECO:0000269|PubMed:16041044}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Chain (1); Mutagenesis (3); Site (1); Topological domain (2); Transmembrane (1) |
| Keywords | 3D-structure;Cell membrane;Hydrolase;Membrane;Protease;Thiol protease;Transmembrane;Transmembrane helix |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cell membrane {ECO:0000250|UniProtKB:Q2FV99}; Single-pass type II membrane protein {ECO:0000250|UniProtKB:Q2FV99}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | NMR spectroscopy (2) |
| Cross Reference PDB | 2KW8; 2RUI; |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 23,151 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |