| IED ID | IndEnz0002008824 |
| Enzyme Type ID | protease008824 |
| Protein Name |
Serine protease inhibitor 1 protein Inhibitor of serine protease-like protein 1 Putative trypsin inhibitor isl-1 |
| Gene Name | spi-1 isl-1 R10H1.4 |
| Organism | Caenorhabditis elegans |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Nematoda (roundworms) Chromadorea Rhabditida Rhabditina Rhabditomorpha Rhabditoidea Rhabditidae Peloderinae Caenorhabditis Caenorhabditis elegans |
| Enzyme Sequence | MKHLLIVSLVFVTIIWKIECETDMYDDSSIVKTEETEEVKPCGLNEVWMVCSSCEEECGKTPQPCPRICQPARCQCPAHKGYRRDGQGNCIFCHDSVPKL |
| Enzyme Length | 100 |
| Uniprot Accession Number | Q8MPZ7 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (5); Domain (1); Signal peptide (1) |
| Keywords | Disulfide bond;Protease inhibitor;Reference proteome;Secreted;Serine protease inhibitor;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..20; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 10778742; 21177967; 22267497; 22560298; 23800452; 24884423; 25487147; 6593563; |
| Motif | |
| Gene Encoded By | |
| Mass | 11,366 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |