| IED ID | IndEnz0002008845 |
| Enzyme Type ID | protease008845 |
| Protein Name |
Subtilisin-like protease 3 EC 3.4.21.- Destructin-3 Serine protease 3 PdSP3 |
| Gene Name | SP3 GMDG_04447 |
| Organism | Pseudogymnoascus destructans (strain ATCC MYA-4855 / 20631-21) (Bat white-nose syndrome fungus) (Geomyces destructans) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Pezizomycotina leotiomyceta sordariomyceta Leotiomycetes Leotiomycetes incertae sedis Pseudeurotiaceae Pseudogymnoascus Pseudogymnoascus destructans Pseudogymnoascus destructans (strain ATCC MYA-4855 / 20631-21) (Bat white-nose syndrome fungus) (Geomyces destructans) |
| Enzyme Sequence | MLFSKSLVALVACFLPLIVSATELKLRNAAATNVAADSYIVVYKDIDDSTFESEMFNVHSFLSKRDSTFRGLGHKYKMPKFKGYQIESDMDTVNRISQSPHVAYVDKDVKVSAYDLSVRIGAPWGLDRISHRNGTSPGLEEYTYDSSAGGGTTIYIIDTGVYIEHVEFEGRATFGANFIPGSPDTDEDGHGTHVAGIAAGANFGVASKAKIIAVRVLDANGDGKGSNVLAGMQWAADDAGKKNQTAKSVINMSLGADYSEAFNKATEAIIAKGIVVVAAAGNEDANASGVSPASTVDAITVGATDRNDSRAAFSNWGVALDVFAPGVDILSAWIGGKDANKTISGTSMACPHVAGLAAYFIGLEKNGTSTPSKIATKIKGVATKNVVLHPKNSRDNLAYNDDGY |
| Enzyme Length | 404 |
| Uniprot Accession Number | L8GD75 |
| Absorption | |
| Active Site | ACT_SITE 158; /note=Charge relay system; /evidence=ECO:0000255|PROSITE-ProRule:PRU01240; ACT_SITE 190; /note=Charge relay system; /evidence=ECO:0000255|PROSITE-ProRule:PRU01240; ACT_SITE 347; /note=Charge relay system; /evidence=ECO:0000255|PROSITE-ProRule:PRU01240 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.21.- |
| Enzyme Function | FUNCTION: Secreted subtilisin-like serine endopeptidase (PubMed:25944934). Mediates the degradation of collagen, the major structural protein in the mammalian host. Degrades the nonhelical regions of collagen that function in the cross-linking of the helical components (By similarity). May function as virulence factor involved in epidermal wing necrosis observed in white nose syndrome (WNS) in bats (By similarity). {ECO:0000250|UniProtKB:L8FSM5, ECO:0000250|UniProtKB:L8G6I7, ECO:0000269|PubMed:25944934}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Chain (1); Domain (2); Glycosylation (7); Propeptide (1); Signal peptide (1); Site (1) |
| Keywords | Glycoprotein;Hydrolase;Protease;Reference proteome;Secreted;Serine protease;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:25944934}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..20; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 42,540 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |