| IED ID | IndEnz0002008850 |
| Enzyme Type ID | protease008850 |
| Protein Name |
Subtilisin propeptide-like protein PfSUB1-ProM |
| Gene Name | PF3D7_0507400 |
| Organism | Plasmodium falciparum (isolate 3D7) |
| Taxonomic Lineage | cellular organisms Eukaryota Sar Alveolata Apicomplexa Aconoidasida Haemosporida (haemosporidians) Plasmodiidae Plasmodium Plasmodium (Laverania) Plasmodium falciparum Plasmodium falciparum (isolate 3D7) |
| Enzyme Sequence | MKFLFAFNFFSLYIYLYEFLCIHLCGSQVTPAGTVLNSNSALISRRINRRKMKNCNNNDLLKVLKMETTYNELPAHNLLMSSKNDINKLFDYINKNEELSKLMNSCGTYVYLKYLGVVIFSIKENVQISHLSEFIQYLLNKNVCIEFNQNVML |
| Enzyme Length | 153 |
| Uniprot Accession Number | C0H4D0 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Acts as a specific inhibitor of subtilisin-like protease SUB1. {ECO:0000269|PubMed:31942933}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Region (1); Signal peptide (1) |
| Keywords | Cell membrane;Membrane;Reference proteome;Secreted;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000305|PubMed:31942933}. Parasitophorous vacuole lumen {ECO:0000305|PubMed:31942933}. Cell membrane {ECO:0000305|PubMed:31942933}; Peripheral membrane protein {ECO:0000305}; Extracellular side {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..27; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 17,892 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |