| IED ID | IndEnz0002008874 |
| Enzyme Type ID | protease008874 |
| Protein Name |
Probable peptidoglycan D,D-transpeptidase PenA EC 3.4.16.4 Penicillin-binding protein 2 PBP-2 Fragment |
| Gene Name | penA |
| Organism | Neisseria flavescens |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Betaproteobacteria Neisseriales Neisseriaceae Neisseria Neisseria flavescens |
| Enzyme Sequence | NIDGKGQEGLELSREDSLRGEDGAKVVLRDNKGNIVDSLDSPRNSVPKNGQDMILSLDQRIQTLAYDELNKAVAYHKAKAGAVVVLDAQTGEILALVNSPAYDPNQPGQANSEQRRNRAVTDMIEPGSAMKPFTIAKALDSGKVDPTDTFNTLPYKIGPATVQDTHVYPTLDVRGIMQKSSNVGTSKLSAMFTPKEMYDFYHDLGVGVRMHSGFPGETAGLLRSWRRWQKIEQATMSFGYGLQLSLLQLARAYTVLTHDGELLPVSFEKQAVAPKGKRVIKASTAKKVRELMVSVTEAGGTGIAGAVDGFDVGAKTGTARKLVNGRYVDNKHVGTFIGFAPAKNPRVIVAVTIDEPTANGYYGGVVAGPVFKEVMSGSLNILGVSPTKPLSNTATVKVPS |
| Enzyme Length | 400 |
| Uniprot Accession Number | P16873 |
| Absorption | |
| Active Site | ACT_SITE 128; /note=Acyl-ester intermediate; /evidence=ECO:0000250|UniProtKB:P0AD68 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Preferential cleavage: (Ac)(2)-L-Lys-D-Ala-|-D-Ala. Also transpeptidation of peptidyl-alanyl moieties that are N-acyl substituents of D-alanine.; EC=3.4.16.4; Evidence={ECO:0000250|UniProtKB:P0AD68}; |
| DNA Binding | |
| EC Number | 3.4.16.4 |
| Enzyme Function | FUNCTION: Catalyzes cross-linking of the peptidoglycan cell wall at the division septum. {ECO:0000250|UniProtKB:P0AD68}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | PATHWAY: Cell wall biogenesis; peptidoglycan biosynthesis. {ECO:0000250|UniProtKB:P0AD68}. |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Non-terminal residue (1); Region (1) |
| Keywords | Antibiotic resistance;Carboxypeptidase;Cell cycle;Cell division;Cell inner membrane;Cell membrane;Cell shape;Cell wall biogenesis/degradation;Hydrolase;Membrane;Peptidoglycan synthesis;Protease;Septation;Transmembrane;Transmembrane helix |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cell inner membrane {ECO:0000250|UniProtKB:P0AD68}; Single-pass membrane protein {ECO:0000250|UniProtKB:P0AD68}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 42,861 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |