| IED ID | IndEnz0002008877 |
| Enzyme Type ID | protease008877 |
| Protein Name |
Protein ORF3 pORF3 |
| Gene Name | ORF3 |
| Organism | Hepatitis E virus genotype 2 (isolate Human/Mexico) (HEV-2) |
| Taxonomic Lineage | Viruses Riboviria Orthornavirae Kitrinoviricota Alsuviricetes Hepelivirales Hepeviridae Orthohepevirus Hepatitis E virus (HEV) Hepatitis E virus genotype 2 (isolate Human/Mexico) (HEV-2) |
| Enzyme Sequence | MGSPPCALGLFCCCSSCFCLCCPRHRPVSRLAAVVGGAAAVPAVVSGVTGLILSPSQSPIFIQPTPLPQTLPLRPGLDLAFANQPGHLAPLGEIRPSAPPLPPVADLPQPGLRR |
| Enzyme Length | 114 |
| Uniprot Accession Number | Q03499 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Plays critical roles in the final steps of viral release by interacting with host TSG101, a member of the vacuolar protein-sorting pathway and using other cellular host proteins involved in vesicle formation pathway. Acts also as a viroporin and forms ion conductive pores allowing viral particle release. Impairs the generation of type I interferon by down-regulating host TLR3 and TLR7 as well as their downstream signaling pathways. {ECO:0000250|UniProtKB:Q81870}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Erroneous initiation (1); Region (6); Transmembrane (1) |
| Keywords | Host cytoplasm;Host endoplasmic reticulum;Host membrane;Host-virus interaction;Inhibition of host innate immune response by virus;Membrane;Phosphoprotein;Transmembrane;Transmembrane helix;Viral immunoevasion |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Host endoplasmic reticulum membrane {ECO:0000250|UniProtKB:Q81870}. Host cytoplasm {ECO:0000250|UniProtKB:O90299}. Note=The N-terminal region seems to associate with the cytoskeleton probably via one of its hydrophobic regions. {ECO:0000250|UniProtKB:O90299}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 11,651 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |