| IED ID | IndEnz0002008898 |
| Enzyme Type ID | protease008898 |
| Protein Name |
Streptogrisin-C EC 3.4.21.- SGPC Serine protease C |
| Gene Name | sprC |
| Organism | Streptomyces griseus |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Actinobacteria Actinomycetia (high G+C Gram-positive bacteria) Streptomycetales Streptomycetaceae Streptomyces Streptomyces griseus group Streptomyces griseus subgroup Streptomyces griseus |
| Enzyme Sequence | MERTTLRRRALVAGTATVAVGALALAGLTGVASADPAATAAPPVSADSLSPGMLAALERDLGLDEDAARSRIANEYRAAAVAAGLEKSLGARYAGARVSGAKATLTVATTDASEAARITEAGARAEVVGHSLDRFEGVKKSLDKAALDKAPKNVPVWYVDVAANRVVVNAASPAAGQAFLKVAGVDRGLVTVARSAEQPRALADIRGGDAYYMNGSGRCSVGFSVTRGTQNGFATAGHCGRVGTTTNGVNQQAQGTFQGSTFPGRDIAWVATNANWTPRPLVNGYGRGDVTVAGSTASVVGASVCRSGSTTGWHCGTIQQLNTSVTYPEGTISGVTRTSVCAEPGDSGGSYISGSQAQGVTSGGSGNCSSGGTTYFQPINPLLQAYGLTLVTSGGGTPTDPPTTPPTDSPGGTWAVGTAYAAGATVTYGGATYRCLQAHTAQPGWTPADVPALWQRV |
| Enzyme Length | 457 |
| Uniprot Accession Number | P52320 |
| Absorption | |
| Active Site | ACT_SITE 238; /note=Charge relay system; ACT_SITE 266; /note=Charge relay system; ACT_SITE 347; /note=Charge relay system |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.21.- |
| Enzyme Function | FUNCTION: Hydrolysis of proteins with specificity similar to chymotrypsin. May be specialized for the degradation of chitin-linked proteins. Has a primary specificity for large aliphatic or aromatic amino acids. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Chain (1); Disulfide bond (3); Domain (1); Propeptide (1); Region (3); Signal peptide (1) |
| Keywords | Disulfide bond;Hydrolase;Protease;Serine protease;Signal;Zymogen |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | PTM: Predicted to be exported by the Tat system. The position of the signal peptide cleavage has not been experimentally proven. |
| Signal Peptide | SIGNAL 1..34; /note=Tat-type signal; /evidence=ECO:0000255|PROSITE-ProRule:PRU00648 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 46,029 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |