| IED ID | IndEnz0002008904 |
| Enzyme Type ID | protease008904 |
| Protein Name |
Phosphatidylserine decarboxylase proenzyme EC 4.1.1.65 Cleaved into: Phosphatidylserine decarboxylase alpha chain; Phosphatidylserine decarboxylase beta chain |
| Gene Name | psd HCH_05397 |
| Organism | Hahella chejuensis (strain KCTC 2396) |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Oceanospirillales Hahellaceae Hahella Hahella chejuensis Hahella chejuensis (strain KCTC 2396) |
| Enzyme Sequence | MSLFDRLFILSQHLTPQHALSRAIGKLADSRTPFIKNTFIKWFIKRYNVNMQEALLPSAEDYTCFNDFFTRALKDGARPIHPDVSRLVTPVDGAVSQAGSIDYGKIFQAKGHSFSLVELLGGDLQRAQPFIGGEFATIYLSPKDYHRIHMPIDGELREMIFVPGKLYSVNPLTTENVPALFARNERVVCIFDTPLGPMSMTLVGAMIVASVETIWAGRVAPMSKTVRSYTYKPGEVTIKRGEEMGRFCLGSTVVMTFPKGAMRWREGLKAETPVRLGEDLGKILQTVATVDEQKTD |
| Enzyme Length | 296 |
| Uniprot Accession Number | Q2SBA8 |
| Absorption | |
| Active Site | ACT_SITE 92; /note=Charge relay system; for autoendoproteolytic cleavage activity; /evidence=ECO:0000255|HAMAP-Rule:MF_00662; ACT_SITE 149; /note=Charge relay system; for autoendoproteolytic cleavage activity; /evidence=ECO:0000255|HAMAP-Rule:MF_00662; ACT_SITE 251; /note=Charge relay system; for autoendoproteolytic cleavage activity; /evidence=ECO:0000255|HAMAP-Rule:MF_00662; ACT_SITE 251; /note=Schiff-base intermediate with substrate; via pyruvic acid; for decarboxylase activity; /evidence=ECO:0000255|HAMAP-Rule:MF_00662 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=a 1,2-diacyl-sn-glycero-3-phospho-L-serine + H(+) = a 1,2-diacyl-sn-glycero-3-phosphoethanolamine + CO2; Xref=Rhea:RHEA:20828, ChEBI:CHEBI:15378, ChEBI:CHEBI:16526, ChEBI:CHEBI:57262, ChEBI:CHEBI:64612; EC=4.1.1.65; Evidence={ECO:0000255|HAMAP-Rule:MF_00662}; |
| DNA Binding | |
| EC Number | 4.1.1.65 |
| Enzyme Function | FUNCTION: Catalyzes the formation of phosphatidylethanolamine (PtdEtn) from phosphatidylserine (PtdSer). {ECO:0000255|HAMAP-Rule:MF_00662}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | PATHWAY: Phospholipid metabolism; phosphatidylethanolamine biosynthesis; phosphatidylethanolamine from CDP-diacylglycerol: step 2/2. {ECO:0000255|HAMAP-Rule:MF_00662}. |
| nucleotide Binding | |
| Features | Active site (4); Chain (2); Modified residue (1); Site (1) |
| Keywords | Cell membrane;Decarboxylase;Lipid biosynthesis;Lipid metabolism;Lyase;Membrane;Phospholipid biosynthesis;Phospholipid metabolism;Pyruvate;Reference proteome;Zymogen |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cell membrane {ECO:0000255|HAMAP-Rule:MF_00662}; Peripheral membrane protein {ECO:0000255|HAMAP-Rule:MF_00662}. |
| Modified Residue | MOD_RES 251; /note=Pyruvic acid (Ser); by autocatalysis; /evidence=ECO:0000255|HAMAP-Rule:MF_00662 |
| Post Translational Modification | PTM: Is synthesized initially as an inactive proenzyme. Formation of the active enzyme involves a self-maturation process in which the active site pyruvoyl group is generated from an internal serine residue via an autocatalytic post-translational modification. Two non-identical subunits are generated from the proenzyme in this reaction, and the pyruvate is formed at the N-terminus of the alpha chain, which is derived from the carboxyl end of the proenzyme. The autoendoproteolytic cleavage occurs by a canonical serine protease mechanism, in which the side chain hydroxyl group of the serine supplies its oxygen atom to form the C-terminus of the beta chain, while the remainder of the serine residue undergoes an oxidative deamination to produce ammonia and the pyruvoyl prosthetic group on the alpha chain. During this reaction, the Ser that is part of the protease active site of the proenzyme becomes the pyruvoyl prosthetic group, which constitutes an essential element of the active site of the mature decarboxylase. {ECO:0000255|HAMAP-Rule:MF_00662}. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 33,038 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:20828 |
| Cross Reference Brenda |