| IED ID | IndEnz0002008914 | 
| Enzyme Type ID | protease008914 | 
| Protein Name | 
                        
                            
                                Rhomboid-related protein 1  RRP EC 3.4.21.105 Rhomboid-like protein 1 Fragment  | 
                    
| Gene Name | Rhbdl1 Rhbdl | 
| Organism | Rattus norvegicus (Rat) | 
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Rattus Rattus norvegicus (Rat) | 
| Enzyme Sequence | FMHVGLEQLGFNALLQLMIGVPLEMVHGVLRISLLYLAGVLAGSLTVSITDMRAPVVGGSGGVYALCSAHLANVVMNWAGMRCPYKLLRMVLALVCMSSEVGRAVWLRFSPPLPASGPQPSFMAHLAGAVVGVSMGLTILRSYEERLRDQCGWWVVLLAYGTFL | 
| Enzyme Length | 164 | 
| Uniprot Accession Number | O88779 | 
| Absorption | |
| Active Site | ACT_SITE 60; /note=Nucleophile; /evidence=ECO:0000250; ACT_SITE 125; /evidence=ECO:0000250 | 
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Cleaves type-1 transmembrane domains using a catalytic dyad composed of serine and histidine that are contributed by different transmembrane domains.; EC=3.4.21.105; | 
| DNA Binding | |
| EC Number | 3.4.21.105 | 
| Enzyme Function | FUNCTION: May be involved in regulated intramembrane proteolysis and the subsequent release of functional polypeptides from their membrane anchors. {ECO:0000250}. | 
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Chain (1); Non-terminal residue (2); Transmembrane (4) | 
| Keywords | Hydrolase;Membrane;Protease;Reference proteome;Serine protease;Transmembrane;Transmembrane helix | 
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Membrane; Multi-pass membrane protein. | 
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - | 
| Mapped Pubmed ID | - | 
| Motif | |
| Gene Encoded By | |
| Mass | 17,662 | 
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |