| IED ID | IndEnz0002008918 |
| Enzyme Type ID | protease008918 |
| Protein Name |
Resuscitation-promoting factor RpfC EC 3.-.-.- |
| Gene Name | rpfC ERDMAN_2076 |
| Organism | Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Actinobacteria Actinomycetia (high G+C Gram-positive bacteria) Corynebacteriales Mycobacteriaceae Mycobacterium Mycobacterium tuberculosis complex Mycobacterium tuberculosis Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman) |
| Enzyme Sequence | MTRIAKPLIKSAMAAGLVTASMSLSTAVAHAGPSPNWDAVAQCESGGNWAANTGNGKYGGLQFKPATWAAFGGVGNPAAASREQQIAVANRVLAEQGLDAWPTCGAASGLPIALWSKPAQGIKQIINEIIWAGIQASIPR |
| Enzyme Length | 140 |
| Uniprot Accession Number | H8F3N4 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.-.-.- |
| Enzyme Function | FUNCTION: Factor that stimulates resuscitation of dormant cells. Has peptidoglycan (PG) hydrolytic activity (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Signal peptide (1) |
| Keywords | Hydrolase;Secreted;Signal |
| Interact With | |
| Induction | INDUCTION: By the metal chelator phenanthroline via Rip1. {ECO:0000269|PubMed:16034419, ECO:0000269|PubMed:20545848}. |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..31; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 14,293 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |