| IED ID | IndEnz0002008919 |
| Enzyme Type ID | protease008919 |
| Protein Name |
Protease RseP EC 3.4.24.- S2P endopeptidase Site-2 protease RseP S2P protease RseP Site-2-type intramembrane protease Fragment |
| Gene Name | rseP |
| Organism | Photorhabdus luminescens (Xenorhabdus luminescens) |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Morganellaceae Photorhabdus Photorhabdus luminescens (Xenorhabdus luminescens) |
| Enzyme Sequence | VEKVIPGSAAEKAGLQKGDRIVKVGSQEIDVWHTFTSFVSNNPNVPLELSVDRAGHIISLSMTPEVRQQSGGRKVGFAGVELRIVPLADEYKIVQQYGPFSAMYQAGDKTWQLMRLTVSMIGKLIVGDVKINNLSGPISIAKGAGVSADSGLVYYLMFLALISVNLGIINLIPLPVLDGGHLLFLFIEKIKGGPVSERVQDFSYRIGAMILVLLMGLALFNDFSRF |
| Enzyme Length | 226 |
| Uniprot Accession Number | Q9S342 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.24.- |
| Enzyme Function | FUNCTION: A site-2 regulated intramembrane protease (S2P) that cleaves the peptide bond between 'Ala-108' and 'Cys-109' in the transmembrane region of RseA. Part of a regulated intramembrane proteolysis (RIP) cascade. Acts on DegS-cleaved RseA to release the cytoplasmic domain of RseA. This provides the cell with sigma-E (RpoE) activity through the proteolysis of RseA (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Domain (1); Non-terminal residue (1); Transmembrane (2) |
| Keywords | Cell inner membrane;Cell membrane;Hydrolase;Membrane;Metalloprotease;Protease;Transmembrane;Transmembrane helix;Zinc |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cell inner membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 24,535 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |