| IED ID | IndEnz0002008957 | 
| Enzyme Type ID | protease008957 | 
| Protein Name | 
                        
                            
                                Serpin A12  OL-64 Visceral adipose tissue-derived serine protease inhibitor Vaspin Visceral adipose-specific serpin  | 
                    
| Gene Name | SERPINA12 | 
| Organism | Homo sapiens (Human) | 
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Homininae Homo Homo sapiens (Human) | 
| Enzyme Sequence | MNPTLGLAIFLAVLLTVKGLLKPSFSPRNYKALSEVQGWKQRMAAKELARQNMDLGFKLLKKLAFYNPGRNIFLSPLSISTAFSMLCLGAQDSTLDEIKQGFNFRKMPEKDLHEGFHYIIHELTQKTQDLKLSIGNTLFIDQRLQPQRKFLEDAKNFYSAETILTNFQNLEMAQKQINDFISQKTHGKINNLIENIDPGTVMLLANYIFFRARWKHEFDPNVTKEEDFFLEKNSSVKVPMMFRSGIYQVGYDDKLSCTILEIPYQKNITAIFILPDEGKLKHLEKGLQVDTFSRWKTLLSRRVVDVSVPRLHMTGTFDLKKTLSYIGVSKIFEEHGDLTKIAPHRSLKVGEAVHKAELKMDERGTEGAAGTGAQTLPMETPLVVKIDKPYLLLIYSEKIPSVLFLGKIVNPIGK | 
| Enzyme Length | 414 | 
| Uniprot Accession Number | Q8IW75 | 
| Absorption | |
| Active Site | |
| Activity Regulation | ACTIVITY REGULATION: Inhibition of KLK7 is enhanced by heparin. {ECO:0000269|PubMed:26199422, ECO:0000269|PubMed:28668641}. | 
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Adipokine that modulates insulin action by specifically inhibiting its target protease KLK7 in white adipose tissues. {ECO:0000269|PubMed:16030142, ECO:0000269|PubMed:23370777, ECO:0000269|PubMed:26199422, ECO:0000269|PubMed:28668641}. | 
| Temperature Dependency | BIOPHYSICOCHEMICAL PROPERTIES: Temperature dependence: Highly thermostable, with a Tm value of 70 degrees Celsius. Incubation at 60 degrees Celsius for two hours has no apparent effect on KLK7 inhibition activity. Polymerization is observed at 70 degrees Celsius and above. {ECO:0000269|PubMed:26199422, ECO:0000269|PubMed:26529565}; | 
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (16); Chain (1); Glycosylation (3); Helix (12); Mutagenesis (9); Natural variant (3); Region (1); Signal peptide (1); Site (1); Turn (5) | 
| Keywords | 3D-structure;Glycoprotein;Protease inhibitor;Reference proteome;Secreted;Serine protease inhibitor;Signal | 
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000305|PubMed:28668641}. | 
| Modified Residue | |
| Post Translational Modification | PTM: Glycosylation slightly decreases affinity for heparin, but otherwise has no significant effect on KLK7 inhibitory activity or thermal stability of the protein. {ECO:0000269|PubMed:28668641}. | 
| Signal Peptide | SIGNAL 1..20; /evidence=ECO:0000250 | 
| Structure 3D | X-ray crystallography (4) | 
| Cross Reference PDB | 4IF8; 4Y3K; 4Y40; 5EI0; | 
| Mapped Pubmed ID | - | 
| Motif | |
| Gene Encoded By | |
| Mass | 47,175 | 
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |