| IED ID | IndEnz0002008958 |
| Enzyme Type ID | protease008958 |
| Protein Name |
Protease inhibitor SILA-3 SLPI Trypsin inhibitor STI1 |
| Gene Name | sti1 |
| Organism | Streptomyces lividans |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Actinobacteria Actinomycetia (high G+C Gram-positive bacteria) Streptomycetales Streptomycetaceae Streptomyces Streptomyces lividans |
| Enzyme Sequence | MRNTARWAATLGLTATAVCGPLAGASLASPATAPASLYAPSALVLTVGHGESAATAAPLRAVTLTCAPTASGTHPAAAAACAELRAAHGDPSALAAEDSVMCTREYAPVVVTVDGVWQGRRLSYERTFANECVKNAGSASVFTF |
| Enzyme Length | 144 |
| Uniprot Accession Number | P61153 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Strong inhibitory activity toward subtilisin BPN' and, to a lesser extent, toward trypsin. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (2); Signal peptide (1); Site (1) |
| Keywords | Direct protein sequencing;Disulfide bond;Protease inhibitor;Secreted;Serine protease inhibitor;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..35; /evidence="ECO:0000269|PubMed:1737780, ECO:0000269|PubMed:7763545" |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 14,433 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |