| IED ID | IndEnz0002008983 | 
| Enzyme Type ID | protease008983 | 
| Protein Name | 
                        
                            
                                Small, acid-soluble spore protein C1  ASSP SASP SSP-2  | 
                    
| Gene Name | sspC1 ssp2 CPE2064 | 
| Organism | Clostridium perfringens (strain 13 / Type A) | 
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Clostridia Eubacteriales Clostridiaceae Clostridium Clostridium perfringens Clostridium perfringens (strain 13 / Type A) | 
| Enzyme Sequence | MSQHLVPEAKNGLSKFKNEVAAEMGVPFSDYNGDLSSKQCGSVGGEMVKRMVEQYEKGI | 
| Enzyme Length | 59 | 
| Uniprot Accession Number | P21886 | 
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: SASP are bound to spore DNA. They are double-stranded DNA-binding proteins that cause DNA to change to an a-like conformation. They protect the DNA backbone from chemical and enzymatic cleavage and are thus involved in dormant spore's high resistance to UV light. | 
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Initiator methionine (1); Site (1) | 
| Keywords | DNA-binding;Direct protein sequencing;Reference proteome;Sporulation | 
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | PTM: SASP are degraded in the first minutes of spore germination and provide amino acids for both new protein synthesis and metabolism. | 
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - | 
| Mapped Pubmed ID | - | 
| Motif | |
| Gene Encoded By | |
| Mass | 6,437 | 
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |