| IED ID |
IndEnz0002008985 |
| Enzyme Type ID |
protease008985 |
| Protein Name |
Secretion monitor
|
| Gene Name |
secM SG0456 |
| Organism |
Sodalis glossinidius (strain morsitans) |
| Taxonomic Lineage |
cellular organisms
Bacteria
Proteobacteria
Gammaproteobacteria
Enterobacterales
Bruguierivoracaceae
Sodalis (tsetse S-endosymbionts)
Sodalis glossinidius
Sodalis glossinidius (strain morsitans)
|
| Enzyme Sequence |
MGILNRWRQIGRRYFWPHLLLGIVAAGFGVPLLPGGGQEMLYQADNCPSLSRQSAFQAGFSQLARLKDVPCRTTYAVDYWHQHAIRTVIRHLSIAWAPAPLPEAVAPLRVQHQVLLTTLGLLLNREARPPVLVRRLRSTGHVAFIDNRSGIRLTQQQGIRAGPHAAV |
| Enzyme Length |
167 |
| Uniprot Accession Number |
Q2NVU4 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
FUNCTION: Regulates secA expression by translational coupling of the secM secA operon. Translational pausing at a specific Pro residue 5 residues before the end of the protein may allow disruption of a mRNA repressor helix that normally suppresses secA translation initiation (By similarity). {ECO:0000250}. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1); Signal peptide (1) |
| Keywords |
Cytoplasm;Periplasm;Reference proteome;Signal |
| Interact With |
|
| Induction |
|
| Subcellular Location |
SUBCELLULAR LOCATION: Cytoplasm, cytosol {ECO:0000250}. Periplasm {ECO:0000250}. Note=The active form is cytosolic, while the periplasmic form is rapidly degraded, mainly by the tail-specific protease. {ECO:0000250}. |
| Modified Residue |
|
| Post Translational Modification |
|
| Signal Peptide |
SIGNAL 1..29; /evidence=ECO:0000255 |
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
|
| Mass |
18,620 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|