| IED ID |
IndEnz0002008995 |
| Enzyme Type ID |
protease008995 |
| Protein Name |
Secreted RxLR effector protein PITG_15718
|
| Gene Name |
PITG_15718 |
| Organism |
Phytophthora infestans (strain T30-4) (Potato late blight fungus) |
| Taxonomic Lineage |
cellular organisms
Eukaryota
Sar
Stramenopiles
Oomycota
Peronosporales
Peronosporaceae
Phytophthora
Phytophthora infestans (Potato late blight agent) (Botrytis infestans)
Phytophthora infestans (strain T30-4) (Potato late blight fungus)
|
| Enzyme Sequence |
MRRYAALMVIDAVLLSTSQALSSSHASELRSQLSAADAMFPSAERDGGIPNKRSLRRISVTESNDGERDEERGFQISILTKLQKWATKMKLPKTTKNLQFRIWPKEKKDPKAVYAELKLAGLDPKAAKANPEFADYLAYSKIWNHRGGRYMTRS |
| Enzyme Length |
154 |
| Uniprot Accession Number |
P0CU89 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
FUNCTION: Secreted effector that is involved in host plant infection (PubMed:31234322). Increases the susceptibility to P.infestans and reduces the plant growth (PubMed:31234322). Affects the expression of host genes (PubMed:31234322). PITG_15718-induced genes such as abscisic acid 8'-hydroxylase, a homolog of a salicylic acid-binding protein or a cysteine protease inhibitor gene, may negatively regulate the plant immunity or vegetative growth (PubMed:31234322). The down-regulated genes include cytochrome P450 monooxygenases essential for lignification and defense against predators and pathogens, and a member of YUCCA gene family, which is an important regulator of the phytohormone indole-3-acetic acid (IAA) biosynthesis (PubMed:31234322). Reduction of the content of IAA particularly results in the suppression of the plant immunity and reduced growth (PubMed:31234322). {ECO:0000269|PubMed:31234322}. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1); Motif (1); Region (1); Signal peptide (1) |
| Keywords |
Reference proteome;Secreted;Signal;Virulence |
| Interact With |
|
| Induction |
INDUCTION: Expression is up-regulated during the infection stage of P.infestans with an increase to over 1900-fold when the sporangium and zoospore attach to plant tissue (PubMed:31234322). High expression levels are then maintained throughout the infection phase (PubMed:31234322). {ECO:0000269|PubMed:31234322}. |
| Subcellular Location |
SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:31234322}. Host cell {ECO:0000269|PubMed:31234322}. |
| Modified Residue |
|
| Post Translational Modification |
|
| Signal Peptide |
SIGNAL 1..20; /evidence=ECO:0000255 |
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
MOTIF 53..72; /note=RxLR-dEER; /evidence=ECO:0000305|PubMed:31234322 |
| Gene Encoded By |
|
| Mass |
17,417 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|