| IED ID | IndEnz0002009003 | 
| Enzyme Type ID | protease009003 | 
| Protein Name | 
                        
                            
                                Signal peptidase complex catalytic subunit SEC11  EC 3.4.21.89 Signal peptidase I  | 
                    
| Gene Name | SEC11 PICST_36729 | 
| Organism | Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) (Yeast) (Pichia stipitis) | 
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Saccharomycotina (true yeasts) Saccharomycetes Saccharomycetales Debaryomycetaceae Scheffersomyces Scheffersomyces stipitis (Yeast) (Pichia stipitis) Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) (Yeast) (Pichia stipitis) | 
| Enzyme Sequence | MNIRQQLTQFLSLAYVFTSAFVIWKSLGIITNSHSPIVVVLSGSMEPAFQRGDILFLWNRDQEAKVGDIVVYEIQGRNIPIVHRVLREHHNSDKQLLLTKGDNNAVDDLGLYAKKQKYLNQKTDLVGSVKAYLPKLGYVTILITENVYFKYGMLGLMCISTLLTNE | 
| Enzyme Length | 166 | 
| Uniprot Accession Number | A3LXS1 | 
| Absorption | |
| Active Site | ACT_SITE 44; /note=Charge relay system; /evidence=ECO:0000250|UniProtKB:P15367; ACT_SITE 83; /note=Charge relay system; /evidence=ECO:0000250|UniProtKB:P15367; ACT_SITE 108; /note=Charge relay system; /evidence=ECO:0000250|UniProtKB:P15367 | 
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Cleavage of hydrophobic, N-terminal signal or leader sequences from secreted and periplasmic proteins.; EC=3.4.21.89; Evidence={ECO:0000250|UniProtKB:P15367}; | 
| DNA Binding | |
| EC Number | 3.4.21.89 | 
| Enzyme Function | FUNCTION: Catalytic component of the signal peptidase complex (SPC) which catalyzes the cleavage of N-terminal signal sequences from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum (By similarity). Specifically cleaves N-terminal signal peptides that contain a hydrophobic alpha-helix (h-region) shorter than 18-20 amino acids (By similarity). {ECO:0000250|UniProtKB:P15367, ECO:0000250|UniProtKB:P67812}. | 
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Chain (1); Region (1); Topological domain (2); Transmembrane (1) | 
| Keywords | Endoplasmic reticulum;Hydrolase;Membrane;Protease;Reference proteome;Signal-anchor;Transmembrane;Transmembrane helix | 
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Endoplasmic reticulum membrane {ECO:0000250|UniProtKB:P15367}; Single-pass type II membrane protein {ECO:0000250|UniProtKB:P15367}. | 
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - | 
| Mapped Pubmed ID | - | 
| Motif | |
| Gene Encoded By | |
| Mass | 18,834 | 
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |