Detail Information for IndEnz0002009068
IED ID IndEnz0002009068
Enzyme Type ID protease009068
Protein Name Proteasome subunit beta type-8
EC 3.4.25.1
Macropain subunit C13
Multicatalytic endopeptidase complex subunit C13
Proteasome component C13
Proteasome subunit beta-5i
Fragment
Gene Name PSMB8
Organism Sus scrofa (Pig)
Taxonomic Lineage cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Laurasiatheria Artiodactyla Suina Suidae (pigs) Sus Sus scrofa (Pig)
Enzyme Sequence RLYYLRNGARISVSAASKLXSNMMYQYRGMGLSMGSMICGWDKKGPGLYYVDENGTRLSGNMFSTGSGNTYAYGVMDSGHRYDLSIEEAYDLGRRAIVHATHRD
Enzyme Length 104
Uniprot Accession Number Q29576
Absorption
Active Site
Activity Regulation
Binding Site
Calcium Binding
catalytic Activity CATALYTIC ACTIVITY: Reaction=Cleavage of peptide bonds with very broad specificity.; EC=3.4.25.1;
DNA Binding
EC Number 3.4.25.1
Enzyme Function FUNCTION: The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This subunit is involved in antigen processing to generate class I binding peptides. May participate in the generation of spliced peptides resulting from the ligation of two separate proteasomal cleavage products that are not contiguous in the parental protein (By similarity). Required for adipocyte differentiation (By similarity). {ECO:0000250, ECO:0000250|UniProtKB:P28062}.
Temperature Dependency
PH Dependency
Pathway
nucleotide Binding
Features Chain (1); Non-terminal residue (2)
Keywords Cytoplasm;Differentiation;Hydrolase;Immunity;Nucleus;Protease;Proteasome;Reference proteome;Threonine protease;Zymogen
Interact With
Induction INDUCTION: Up-regulated by interferon gamma (at protein level).
Subcellular Location SUBCELLULAR LOCATION: Cytoplasm {ECO:0000255|PROSITE-ProRule:PRU00809}. Nucleus {ECO:0000250}.
Modified Residue
Post Translational Modification
Signal Peptide
Structure 3D
Cross Reference PDB -
Mapped Pubmed ID 21140225;
Motif
Gene Encoded By
Mass 11,604
Kinetics
Metal Binding
Rhea ID
Cross Reference Brenda