Detail Information for IndEnz0002009090
IED ID IndEnz0002009090
Enzyme Type ID protease009090
Protein Name Small ubiquitin-related modifier 1
SUMO-1
Gene Name SUMO1 RCJMB04_2j18
Organism Gallus gallus (Chicken)
Taxonomic Lineage cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Sauropsida Sauria (diapsids) Archelosauria Archosauria Dinosauria Saurischia Theropoda Coelurosauria Aves Neognathae Galloanserae Galliformes Phasianidae (turkeys) Phasianinae Gallus Gallus gallus (Chicken)
Enzyme Sequence MSDQEAKPSAEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRITDNHTPKELGMEEEDVIEVYQEQTGGHSTV
Enzyme Length 101
Uniprot Accession Number Q8QGH2
Absorption
Active Site
Activity Regulation
Binding Site
Calcium Binding
catalytic Activity
DNA Binding
EC Number
Enzyme Function FUNCTION: Ubiquitin-like protein that can be covalently attached to proteins as a monomer or a lysine-linked polymer. Covalent attachment via an isopeptide bond to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I. This post-translational modification on lysine residues of proteins plays a crucial role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. Polymeric SUMO1 chains are also susceptible to polyubiquitination which functions as a signal for proteasomal degradation of modified proteins. {ECO:0000250|UniProtKB:P63165}.
Temperature Dependency
PH Dependency
Pathway
nucleotide Binding
Features Chain (1); Cross-link (1); Domain (1); Propeptide (1)
Keywords Cell membrane;Cytoplasm;Isopeptide bond;Membrane;Nucleus;Reference proteome;Ubl conjugation pathway
Interact With
Induction
Subcellular Location SUBCELLULAR LOCATION: Nucleus membrane {ECO:0000250|UniProtKB:P63165}. Nucleus speckle {ECO:0000250|UniProtKB:P63166}. Cytoplasm {ECO:0000250|UniProtKB:P63165}. Nucleus, PML body {ECO:0000250|UniProtKB:P63165}. Cell membrane {ECO:0000250|UniProtKB:P63165}. Nucleus {ECO:0000250|UniProtKB:P63165}.
Modified Residue
Post Translational Modification PTM: Cleavage of precursor form by a sentrin-specific protease is necessary for function. {ECO:0000250|UniProtKB:P63165}.
Signal Peptide
Structure 3D
Cross Reference PDB -
Mapped Pubmed ID -
Motif
Gene Encoded By
Mass 11,557
Kinetics
Metal Binding
Rhea ID
Cross Reference Brenda