| IED ID |
IndEnz0002009122 |
| Enzyme Type ID |
protease009122 |
| Protein Name |
Protease inhibitor III
|
| Gene Name |
cIII lambdap86 |
| Organism |
Escherichia phage lambda (Bacteriophage lambda) |
| Taxonomic Lineage |
Viruses
Duplodnaviria
Heunggongvirae
Uroviricota
Caudoviricetes
Caudovirales
Siphoviridae (phages with long non-contractile tails)
Lambdavirus
Escherichia phage lambda (Bacteriophage lambda)
|
| Enzyme Sequence |
MQYAIAGWPVAGCPSESLLERITRKLRDGWKRLIDILNQPGVPKNGSNTYGYPD |
| Enzyme Length |
54 |
| Uniprot Accession Number |
P03044 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
FUNCTION: Acts as a host protease inhibitor that allows the virus to initiate latency. Following infection, prevents protein cII degradation by inhibiting host protease FtsH (cII is a factor that initiates the expression of repressor cI, the major component promoting latency). Functions as a competitive inhibitor (and thus as alternative substrate) of host FtsH and thereby prevents binding of cII substrate. In turn, stabilization of cII transcriptional activator allows protein cI expression and thus initiation of latency. {ECO:0000269|PubMed:17426811, ECO:0000269|PubMed:18721134, ECO:0000269|PubMed:8990286}. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1); Mutagenesis (1) |
| Keywords |
Activator;Reference proteome;Viral latency;Viral latency initiation and maintenance |
| Interact With |
|
| Induction |
|
| Subcellular Location |
|
| Modified Residue |
|
| Post Translational Modification |
|
| Signal Peptide |
|
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
|
| Mass |
6,047 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|