| IED ID |
IndEnz0002009128 |
| Enzyme Type ID |
protease009128 |
| Protein Name |
ClpXP adapter protein SpxH
|
| Gene Name |
spxH yjbH BSU11550 |
| Organism |
Bacillus subtilis (strain 168) |
| Taxonomic Lineage |
cellular organisms
Bacteria
Terrabacteria group
Firmicutes
Bacilli
Bacillales
Bacillaceae
Bacillus
Bacillus subtilis group
Bacillus subtilis
Bacillus subtilis subsp. subtilis
Bacillus subtilis (strain 168)
|
| Enzyme Sequence |
MTNYQHELYFAHCHGHPKKPLEIYMFVDPLCPECWSLEPVIKKLKIRYGRFFTLRIIASASLTALNKKRKKHLLAEAWEKIASRSGMSCDGNVWFEQDQPLSSPYMAALAFKAAELQGRKAGMQFLRNMQESLFVSKKNITDENVLLEIAENTSLDLEEFKKDLHSQSAVKALQCDMKIAAEMDVSVNPTLTFFNTQHEDEGLKVPGSYSYDVYEEILFEMLGDEPKPSETPPLECFIEYFRFVASKEIALVYDLSLEEVEKEMKKLAFAKKVAKVEAKHGMFWKSLSTYSDEYQSCEK |
| Enzyme Length |
299 |
| Uniprot Accession Number |
O31606 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
ACTIVITY REGULATION: Irreversible aggregation upon several stress conditions prevents interaction with Spx and therefore leads to Spx stabilization (PubMed:25353645). Inhibited by interaction with SpxO/YuzO (PubMed:21378193). {ECO:0000269|PubMed:21378193, ECO:0000269|PubMed:25353645}. |
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
FUNCTION: Adapter protein required for efficient degradation of Spx by ClpXP under non-stress conditions (PubMed:17908206, PubMed:19074380, PubMed:24942655). Interaction with Spx stabilizes Spx and exposes the C-terminus of Spx for recognition and proteolysis by ClpXP (PubMed:24942655, PubMed:27191337). Is specific for Spx and does not enhance proteolysis by ClpCP protease (PubMed:19074380). Probably binds 2 zinc ions (PubMed:19074380). {ECO:0000269|PubMed:17908206, ECO:0000269|PubMed:19074380, ECO:0000269|PubMed:24942655, ECO:0000269|PubMed:27191337}. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1); Mutagenesis (1) |
| Keywords |
Cytoplasm;Metal-binding;Reference proteome;Zinc |
| Interact With |
O31602; O32302 |
| Induction |
INDUCTION: Expressed throughout cell growth. Negatively influences its own expression. {ECO:0000269|PubMed:17908206}. |
| Subcellular Location |
SUBCELLULAR LOCATION: Cytoplasm {ECO:0000255|HAMAP-Rule:MF_02245, ECO:0000269|PubMed:25353645}. Note=Soluble under non-stress conditions and aggregates in response to stress conditions such as disulfide stress, heat and ethanol. {ECO:0000269|PubMed:25353645}. |
| Modified Residue |
|
| Post Translational Modification |
|
| Signal Peptide |
|
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
|
| Mass |
34,422 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|