| IED ID | 
                        IndEnz0002009141 | 
                    
                    
                        | Enzyme Type ID | 
                        protease009141 | 
                    
                    
                        | Protein Name | 
                        
                        
                            
                                Cell division inhibitor SulA 
                            
                        
                         | 
                    
                    
                        | Gene Name | 
                        sulA SARI_01939 | 
                    
                    
                        | Organism | 
                        Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) | 
                    
                    
                        | Taxonomic Lineage | 
                        
                        
                            cellular organisms
                            
                                
                            
                        
                             Bacteria
                            
                                
                            
                        
                             Proteobacteria
                            
                                
                            
                        
                             Gammaproteobacteria
                            
                                
                            
                        
                             Enterobacterales
                            
                                
                            
                        
                             Enterobacteriaceae
                            
                                
                            
                        
                             Salmonella
                            
                                
                            
                        
                             Salmonella enterica (Salmonella choleraesuis)
                            
                                
                            
                        
                             Salmonella enterica subsp. arizonae
                            
                                
                            
                        
                             Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
                            
                        
                         | 
                    
                    
                        | Enzyme Sequence | 
                        MYTSGYANRSSSFPTTTHNAARAATENAAAGLVSEVVYHEDQPMMAQLLLLPLLRHLGQQSRWQLWLTPQQKLSREWVQSAGLPLTKVMQISQLAPPHTLESMIRALRTGNYSVVIGWLTEELTEEEHASLVEAANVGNAVGFIMRPVRAHALPRRQHSGLKIHSNLYH | 
                    
                    
                        | Enzyme Length | 
                        169 | 
                    
                    
                        | Uniprot Accession Number | 
                        
                            A9MHT1 | 
                        
                    
                    
                        | Absorption | 
                         | 
                    
                    
                        | Active Site | 
                         | 
                    
                    
                        | Activity Regulation | 
                         | 
                    
                    
                        | Binding Site | 
                         | 
                    
                    
                        | Calcium Binding | 
                         | 
                    
                    
                        | catalytic Activity | 
                         | 
                    
                    
                        | DNA Binding | 
                         | 
                    
                    
                        | EC Number | 
                         | 
                    
                    
                        | Enzyme Function | 
                        FUNCTION: Component of the SOS system and an inhibitor of cell division. Accumulation of SulA causes rapid cessation of cell division and the appearance of long, non-septate filaments. In the presence of GTP, binds a polymerization-competent form of FtsZ in a 1:1 ratio, thus inhibiting FtsZ polymerization and therefore preventing it from participating in the assembly of the Z ring. This mechanism prevents the premature segregation of damaged DNA to daughter cells during cell division. {ECO:0000255|HAMAP-Rule:MF_01179}. | 
                    
                    
                        | Temperature Dependency | 
                         | 
                    
                    
                        | PH Dependency | 
                         | 
                    
                    
                        | Pathway | 
                         | 
                    
                    
                        | nucleotide Binding | 
                         | 
                    
                    
                        | Features | 
                        Chain (1); Region (2); Site (1) | 
                    
                    
                        | Keywords | 
                        Cell cycle;Cell division;DNA damage;Reference proteome;SOS response;Septation | 
                    
                    
                        | Interact With | 
                         | 
                    
                    
                        | Induction | 
                        INDUCTION: By DNA damage, as part of the SOS response. {ECO:0000255|HAMAP-Rule:MF_01179}. | 
                    
                    
                        | Subcellular Location | 
                         | 
                    
                    
                        | Modified Residue | 
                         | 
                    
                    
                        | Post Translational Modification | 
                        PTM: Is rapidly cleaved and degraded by the Lon protease once DNA damage is repaired. {ECO:0000255|HAMAP-Rule:MF_01179}. | 
                    
                    
                        | Signal Peptide | 
                         | 
                    
                    
                        | Structure 3D | 
                         | 
                    
                    
                        | Cross Reference PDB | 
                        
                            - | 
                        
                    
                    
                        | Mapped Pubmed ID | 
                        
                            - | 
                        
                    
                    
                        | Motif | 
                         | 
                    
                    
                        | Gene Encoded By | 
                         | 
                    
                    
                        | Mass | 
                        18,885 | 
                    
                    
                        | Kinetics | 
                         | 
                    
                    
                        | Metal Binding | 
                         | 
                    
                    
                        | Rhea ID | 
                         | 
                    
                    
                        | Cross Reference Brenda | 
                         |