| IED ID | IndEnz0002009143 |
| Enzyme Type ID | protease009143 |
| Protein Name |
Vesicle-associated membrane protein 1 VAMP-1 Synaptobrevin-1 |
| Gene Name | VAMP1 SYB1 |
| Organism | Homo sapiens (Human) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Homininae Homo Homo sapiens (Human) |
| Enzyme Sequence | MSAPAQPPAEGTEGTAPGGGPPGPPPNMTSNRRLQQTQAQVEEVVDIIRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKRKYWWKNCKMMIMLGAICAIIVVVIVIYFFT |
| Enzyme Length | 118 |
| Uniprot Accession Number | P23763 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Involved in the targeting and/or fusion of transport vesicles to their target membrane. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Alternative sequence (2); Chain (1); Domain (1); Modified residue (1); Mutagenesis (3); Natural variant (1); Region (1); Sequence conflict (1); Site (4); Topological domain (2); Transmembrane (1) |
| Keywords | Alternative splicing;Cell junction;Coiled coil;Congenital myasthenic syndrome;Cytoplasmic vesicle;Disease variant;Membrane;Mitochondrion;Mitochondrion outer membrane;Neurodegeneration;Phosphoprotein;Reference proteome;Synapse;Synaptosome;Transmembrane;Transmembrane helix |
| Interact With | Q8N6L0; O95721; Q12846; Q13520; Q3SXY8; Q9BUF7-2; Q96BA8; P00387; Q15125; Q9GZR5; A1L3X0; Q9Y282; Q96KR6; Q8TDT2; Q13571; Q9H6H4; Q86VR2; Q9Y225-2; Q9NY72; Q9BY50; Q8NHU3; Q8IWU4; Q16623; P61266; Q12846; Q96IK0; Q9NUH8; Q53FP2; Q9Y320; Q12888 |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: [Isoform 1]: Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane {ECO:0000250}; Single-pass type IV membrane protein {ECO:0000250}. Cell junction, synapse, synaptosome {ECO:0000250}.; SUBCELLULAR LOCATION: [Isoform 2]: Cytoplasmic vesicle membrane {ECO:0000250}; Single-pass type IV membrane protein {ECO:0000250}. Cell junction, synapse, synaptosome {ECO:0000250}.; SUBCELLULAR LOCATION: [Isoform 3]: Mitochondrion outer membrane; Single-pass type IV membrane protein {ECO:0000269|PubMed:9658161}. |
| Modified Residue | MOD_RES 63; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:Q62442 |
| Post Translational Modification | PTM: (Microbial infection) Targeted and hydrolyzed by C.botulinum neurotoxin type B (BoNT/B, botB) which probably hydrolyzes the 78-Gln-|-Phe-79 bond and inhibits neurotransmitter release (PubMed:22289120). {ECO:0000269|PubMed:22289120, ECO:0000305|PubMed:22289120}.; PTM: (Microbial infection) Targeted and hydrolyzed by C.botulinum neurotoxin type D (BoNT/D, botD) which probably hydrolyzes the 61-Arg-|-Leu-62 bond and inhibits neurotransmitter release (PubMed:22289120). BoNT/D has low catalytic activity on this protein due to its sequence (PubMed:22289120). Note that humans are not known to be infected by C.botulinum type D. {ECO:0000269|PubMed:22289120, ECO:0000305, ECO:0000305|PubMed:22289120}.; PTM: (Microbial infection) Targeted and hydrolyzed by C.botulinum neurotoxin type F (BoNT/F, botF) which probably hydrolyzes the 60-Gln-|-Lys-61 bond and inhibits neurotransmitter release (PubMed:22289120). {ECO:0000269|PubMed:22289120, ECO:0000305|PubMed:22289120}.; PTM: (Microbial infection) Targeted and hydrolyzed by C.botulinum neurotoxin type X (BoNT/X) which probably hydrolyzes the 68-Arg-|-Ala-69 bond and inhibits neurotransmitter release (PubMed:29540745). It remains unknown whether BoNT/X is ever produced, or what organisms it targets. {ECO:0000269|PubMed:29540745, ECO:0000305|PubMed:29540745}. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 15217342; 16519520; 17903296; 18457912; 20877624; 21330375; 25010769; 25416956; 25881291; 33631708; 7527117; 7910017; 8051110; 8175689; 8226912; 8402889; |
| Motif | |
| Gene Encoded By | |
| Mass | 12,902 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |