| IED ID | IndEnz0002009180 |
| Enzyme Type ID | protease009180 |
| Protein Name |
Cystein proteinase inhibitor protein salarin Cathepsin M |
| Gene Name | salarin catm |
| Organism | Salmo salar (Atlantic salmon) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Actinopterygii Actinopteri Neopterygii Teleostei Osteoglossocephalai Clupeocephala Euteleosteomorpha Protacanthopterygii Salmoniformes (salmons and trouts) Salmonidae (salmonids) Salmoninae (trouts salmons & chars) Salmo Salmo salar (Atlantic salmon) |
| Enzyme Sequence | MKSLVLLLLVAVTVSSVVSKPLPEDSEAEVHKEFETWKVKYGKSYPSTEEEAKRKEMWLATRKKVMEHNTRAGNGLESYTMAVNHLADLTTEEVPKGLLPMPRPEEEEVDKEFEMWKTHNGKTYNSTEEEAKRKEIWLATRARVMEHNKRAENGSESFTMGINYFSDMTFEEIPKARLMVVFPTRDGGEEAEVDKEFETWKVQHGKNYGSTEEEAKRKGIWLATRTRVMEHNKRAETGSESFTMGMNHLSDKTTAEVTGRRLQDGEEAEVHKEFETWKVKYGKTYPSTVEEAKRKEIWLATRKMVMEHNKRAENGLESFTMGVNHFADLTAEEVPRGLFPME |
| Enzyme Length | 342 |
| Uniprot Accession Number | Q70SU8 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Inhibits papain and ficin (cysteine proteinases) but not trypsin (a serine proteinase). {ECO:0000269|PubMed:10583403}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Glycosylation (2); Signal peptide (1) |
| Keywords | Cytoplasm;Direct protein sequencing;Glycoprotein;Protease inhibitor;Reference proteome;Signal;Thiol protease inhibitor;Vacuole |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:12397376}. Vacuole {ECO:0000269|PubMed:12397376}. |
| Modified Residue | |
| Post Translational Modification | PTM: N-glycosylated, with sialylated biantennary complex-type glycans. {ECO:0000269|PubMed:11447131}.; PTM: O-glycosylated, with sialylated oligosaccharides. {ECO:0000269|PubMed:11447131}. |
| Signal Peptide | SIGNAL 1..19; /evidence=ECO:0000269|PubMed:14505823 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 39,496 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |