| IED ID | IndEnz0002009188 |
| Enzyme Type ID | protease009188 |
| Protein Name |
Protease inhibitor BBRPI Cleaved into: Serine protease inhibitor; Serine protease inhibitor C; Serine protease inhibitor B; Serine protease inhibitor A |
| Gene Name | |
| Organism | Brevibacillus choshinensis |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Paenibacillaceae Brevibacillus Brevibacillus choshinensis |
| Enzyme Sequence | MKTIRTGMMTLAALAVLGTNVVSATSEPVKELSVNVNGQHIEQAAIFDKGQQTVLVPLRDVAESLGFQVKWNAETKAAEVNKGAIFSYAKVGEDRYPFAKMYKTLGAEPRLLNGNTYVPVAFVDEILQAEVNVTDDAVTVVDEESDVAPVRTGTITTLNKREDGGVSFQLNGYETGIILHVDKETKITTADGKELKPEDLQLGMEVEATHQKFMAMSMPQSGAVSIVVKSGLETPEVLGTAGKVASIDKDQEGSYKMLVEGQALAENAPEKVALIVGKDTKIVSAKDNKELAPEDLKAEMKVFAYYGPKLTRSLPPIGVAEKIVVE |
| Enzyme Length | 326 |
| Uniprot Accession Number | P43131 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Shows inhibitory activity towards serine proteases, such as trypsin, chymotrypsin and subtilisin. May form a trypsin-inhibitor complex in a molar ratio of 1:1. |
| Temperature Dependency | BIOPHYSICOCHEMICAL PROPERTIES: Temperature dependence: Thermostable at neutral and acidic pHs.; |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (4); Region (1); Repeat (2); Signal peptide (1) |
| Keywords | Direct protein sequencing;Protease inhibitor;Repeat;Secreted;Serine protease inhibitor;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | PTM: Proteolytically cleaved to yield at least three forms (BBRPI-A, -B, and -C). |
| Signal Peptide | SIGNAL 1..24; /evidence=ECO:0000269|PubMed:1610177 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 35,100 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |