| IED ID | IndEnz0002009191 |
| Enzyme Type ID | protease009191 |
| Protein Name |
Seminal vesicle secretory protein 3A Seminal vesicle secretory protein III SVS III |
| Gene Name | Svs3a Svs3 |
| Organism | Mus musculus (Mouse) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) |
| Enzyme Sequence | MKSIFFSLSLLLLLEKKAAGIELYAGGTKGHFLVKTSPLMFIGKNQFLYGHKEEQEEAPEESIFVQTKHHEYGQDADADMGGALSSQELTSLKEDIVCEEEDELAQQKSQLPSQSQIKSQTQVKSYAAQLKSQPGQLKTIGQVKSQTMLKSHGAPLKSFKARLNLREDIPQQVKGRGYGLAEDLAQVRQQPAKVHRLKGKHRQSRKTAAFYPQFRRRSRPYPRYFVQFQEQLQGSVHHTKSFYPGPGMCYCPRGGVILYQDAFTD |
| Enzyme Length | 265 |
| Uniprot Accession Number | F2Z472 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Component of the copulatory plug. {ECO:0000269|PubMed:11723121}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Alternative sequence (1); Chain (1); Region (1); Repeat (5); Sequence conflict (9); Signal peptide (1) |
| Keywords | Alternative splicing;Copulatory plug;Glycoprotein;Reference proteome;Repeat;Secreted;Signal |
| Interact With | |
| Induction | INDUCTION: Up-regulated in response to androgens. {ECO:0000269|PubMed:11723121}. |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:11723121}. |
| Modified Residue | |
| Post Translational Modification | PTM: Glycosylated. {ECO:0000269|PubMed:11723121}.; PTM: Covalently cross-linked by transglutaminase, which is important for the formation of the gelatinous copulatory plug. Five repeats of Q-X-K-(S/T) in the central region of the protein serve as the transglutaminase substrate site(s). {ECO:0000269|PubMed:11723121}. |
| Signal Peptide | SIGNAL 1..20; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 11217851; 12466851; 1517240; 15582586; 6626148; |
| Motif | |
| Gene Encoded By | |
| Mass | 29,967 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |